AMPDB_729 | Protegrin-1

1 General Description

AMPDB ID: AMPDB_729

Protein Names: Protegrin-1 (PG-1) (Neutrophil peptide 1)

Protein Family: Cathelicidin family

Gene Name: NPG1

Source Organism: Sus scrofa (Pig)

Protein Length: 149 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

METQRASLCLGRWSLWLLLLALVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQGVRGGRLCYCRRRFCVCVGRG

FASTA format

Counts of Amino Acids

'A': 9, 'R': 15, 'N': 4, 'D': 8, 'C': 9, 'Q': 8, 'E': 10, 'G': 9, 'H': 0, 'I': 2, 'L': 19, 'K': 6, 'M': 1, 'F': 3, 'P': 11, 'S': 8, 'T': 8, 'W': 2, 'Y': 3, 'V': 14

Frequencies of Amino Acids

'A': 6.04%, 'R': 10.07%, 'N': 2.68%, 'D': 5.37%, 'C': 6.04%, 'Q': 5.37%, 'E': 6.71%, 'G': 6.04%, 'H': 0%, 'I': 1.34%, 'L': 12.75%, 'K': 4.03%, 'M': 0.67%, 'F': 2.01%, 'P': 7.38%, 'S': 5.37%, 'T': 5.37%, 'W': 1.34%, 'Y': 2.01%, 'V': 9.4%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16677.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	88.255	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	37.026	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.307	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.775	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.132	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.457	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.289, 0.215, 0.262 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.054	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15970	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), Listeria monocytogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-candida, Anti-listeria, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Zhao C, Liu L, Lehrer RI, et al. Identification of a new member of the protegrin family by cDNA cloning. FEBS Lett. 1994;346(2-3):285-8. Published 1994 Jun 13. doi:10.1016/0014-5793(94)00493-5

PMID: 8013647

Citation 2: Zhao C, Ganz T, Lehrer RI, et al. The structure of porcine protegrin genes. FEBS Lett. 1995;368(2):197-202. Published 1995 Jul 17. doi:10.1016/0014-5793(95)00633-k

PMID: 7628604

Citation 3: Kokryakov VN, Harwig SS, Panyutich EA, et al. Protegrins: leukocyte antimicrobial peptides that combine features of corticostatic defensins and tachyplesins. FEBS Lett. 1993;327(2):231-6. Published 1993 Jul 26. doi:10.1016/0014-5793(93)80175-t

PMID: 8335113

Citation 4: Mirgorodskaya OA, Shevchenko AA, Abdalla KO, et al. Primary structure of three cationic peptides from porcine neutrophils. Sequence determination by the combined usage of electrospray ionization mass spectrometry and Edman degradation. FEBS Lett. 1993;330(3):339-42. Published 1993 Sep 20. doi:10.1016/0014-5793(93)80900-f

PMID: 8375505

Citation 5: Aumelas A, Mangoni M, Roumestand C, et al. Synthesis and solution structure of the antimicrobial peptide protegrin-1. Eur J Biochem. 1996;237(3):575-83. Published 1996 May 1. doi:10.1111/j.1432-1033.1996.0575p.x

PMID: 8647100

Citation 6: Fahrner RL, Dieckmann T, Harwig SS, et al. Solution structure of protegrin-1, a broad-spectrum antimicrobial peptide from porcine leukocytes. Chem Biol. 1996;3(7):543-50. Published 1996 Jul. doi:10.1016/s1074-5521(96)90145-3

PMID: 8807886

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P32194

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X79868	GenBank \|\| EMBL
2.	X84094	GenBank \|\| EMBL

RefSeq: NP_001116621.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ssc:100144483

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download