AMPDB_724 | Lantibiotic nisin-Z

PEPTIDE SUMMARY

Lantibiotic nisin-Z

1 General Description

AMPDB ID: AMPDB_724

Protein Names: Lantibiotic nisin-Z

Protein Family: Type A lantibiotic family

Gene Name: nisZ

Source Organism: Lactococcus lactis subsp. lactis (Streptococcus lactis)

Protein Length: 57 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 1, 'N': 3, 'D': 3, 'C': 5, 'Q': 0, 'E': 0, 'G': 4, 'H': 1, 'I': 3, 'L': 4, 'K': 6, 'M': 3, 'F': 1, 'P': 2, 'S': 9, 'T': 6, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 5.26%, 'R': 1.75%, 'N': 5.26%, 'D': 5.26%, 'C': 8.77%, 'Q': 0%, 'E': 0%, 'G': 7.02%, 'H': 1.75%, 'I': 5.26%, 'L': 7.02%, 'K': 10.53%, 'M': 5.26%, 'F': 1.75%, 'P': 3.51%, 'S': 15.79%, 'T': 10.53%, 'W': 0%, 'Y': 0%, 'V': 5.26%

Missing Amino Acid(s)

E, Q, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, H, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5939.94 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.421	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.886	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.011	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.313	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.8	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.779	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.193, 0.316, 0.175 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.018	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 250	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Mulders JW, Boerrigter IJ, Rollema HS, et al. Identification and characterization of the lantibiotic nisin Z, a natural nisin variant. Eur J Biochem. 1991;201(3):581-4. Published 1991 Nov 1. doi:10.1111/j.1432-1033.1991.tb16317.x

PMID: 1935953

Citation 2: Immonen T, Ye S, Ra R, et al. The codon usage of the nisZ operon in Lactococcus lactis N8 suggests a non-lactococcal origin of the conjugative nisin-sucrose transposon. DNA Seq. 1995;5(4):203-18. Published 1995. doi:10.3109/10425179509030968

PMID: 7626780

Citation 3: Hsu ST, Breukink E, Tischenko E, et al. The nisin-lipid II complex reveals a pyrophosphate cage that provides a blueprint for novel antibiotics. Nat Struct Mol Biol. 2004;11(10):963-7. Published 2004 Oct. doi:10.1038/nsmb830

PMID: 15361862

5.2 Protein Sequence Databases

UniProt: P29559

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P29559

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X61144	GenBank \|\| EMBL
2.	D10768	GenBank \|\| EMBL
3.	Z18947	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_015425978.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: DB07780

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006079

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download