AMPDB_713 | Lantibiotic gallidermin

PEPTIDE SUMMARY

Lantibiotic gallidermin

1 General Description

AMPDB ID: AMPDB_713

Protein Names: Lantibiotic gallidermin

Protein Family: Type A lantibiotic family

Gene Name: gdmA

Source Organism: Staphylococcus gallinarum

Protein Length: 52 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MEAVKEKNELFDLDVKVNAKESNDSGAEPRIASKFLCTPGCAKTGSFNSYCC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 1, 'N': 4, 'D': 3, 'C': 4, 'Q': 0, 'E': 5, 'G': 3, 'H': 0, 'I': 1, 'L': 3, 'K': 6, 'M': 1, 'F': 3, 'P': 2, 'S': 5, 'T': 2, 'W': 0, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 9.62%, 'R': 1.92%, 'N': 7.69%, 'D': 5.77%, 'C': 7.69%, 'Q': 0%, 'E': 9.62%, 'G': 5.77%, 'H': 0%, 'I': 1.92%, 'L': 5.77%, 'K': 11.54%, 'M': 1.92%, 'F': 5.77%, 'P': 3.85%, 'S': 9.62%, 'T': 3.85%, 'W': 0%, 'Y': 1.92%, 'V': 5.77%

Missing Amino Acid(s)

H, Q, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, M, R, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5647.38 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	56.346	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	22.106	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.446	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.537	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.902	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.242	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.212, 0.269, 0.269 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.077	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1740	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Schnell N, Entian KD, GÃ¶tz F, et al. Structural gene isolation and prepeptide sequence of gallidermin, a new lanthionine containing antibiotic. FEMS Microbiol Lett. 1989;49(2-3):263-7. Published 1989 Apr. doi:10.1016/0378-1097(89)90050-5

PMID: 2765032

Citation 2: Kellner R, Jung G, HÃ¶rner T, et al. Gallidermin: a new lanthionine-containing polypeptide antibiotic. Eur J Biochem. 1988;177(1):53-9. Published 1988 Oct 15. doi:10.1111/j.1432-1033.1988.tb14344.x

PMID: 3181159

Citation 3: Freund S, Jung G, Gutbrod O, et al. The solution structure of the lantibiotic gallidermin. Biopolymers. 1991;31(6):803-11. Published 1991 May. doi:10.1002/bip.360310626

PMID: 1932575

5.2 Protein Sequence Databases

UniProt: P21838

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P21838

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	U61158	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_042739435.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006079

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download