AMPDB_712 | Andropin
PEPTIDE SUMMARY
Andropin
1 General Description
AMPDB ID: AMPDB_712
Protein Names: Andropin
Protein Family: Andropin family
Gene Name: Anp ANR CG1361
Source Organism: Drosophila melanogaster (Fruit fly)
Protein Length: 57 AA
Protein Existence: Evidence at transcript level
2 Protein Sequence & Composition
2.1 Sequence
MKYFVVLVVLALILAISVGPSDAVFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 7, 'R': 0, 'N': 3, 'D': 3, 'C': 0, 'Q': 1, 'E': 2, 'G': 3, 'H': 1, 'I': 7, 'L': 6, 'K': 5, 'M': 1, 'F': 4, 'P': 3, 'S': 2, 'T': 0, 'W': 0, 'Y': 1, 'V': 8
Frequencies of Amino Acids
'A': 12.28%, 'R': 0%, 'N': 5.26%, 'D': 5.26%, 'C': 0%, 'Q': 1.75%, 'E': 3.51%, 'G': 5.26%, 'H': 1.75%, 'I': 12.28%, 'L': 10.53%, 'K': 8.77%, 'M': 1.75%, 'F': 7.02%, 'P': 5.26%, 'S': 3.51%, 'T': 0%, 'W': 0%, 'Y': 1.75%, 'V': 14.04%
Missing Amino Acid(s)
C, R, T, W
Most Occurring Amino Acid(s)
V
Less Occurring Amino Acid(s)
H, M, Q, Y
Hydrophobic Amino Acid(s) Count
39
Hydrophilic Amino Acid(s) Count
18
Basic Amino Acid(s) Count
5
Acidic Amino Acid(s) Count
6
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 6151.39 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 141.93 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 17.572 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.886 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.696 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.539 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 0.091 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.456, 0.193, 0.281 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.088 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1490 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Positive Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Samakovlis C, Kylsten P, Kimbrell DA, et al. The andropin gene and its product, a male-specific antibacterial peptide in Drosophila melanogaster. EMBO J. 1991;10(1):163-9. Published 1991 Jan. doi:10.1002/j.1460-2075.1991.tb07932.x
PMID: 1899226
Citation 2: Clark AG, Wang L, Wang L. Molecular population genetics of Drosophila immune system genes. Genetics. 1997;147(2):713-24. Published 1997 Oct. doi:10.1093/genetics/147.2.713
PMID: 9335607
Citation 3: Date-Ito A, Kasahara K, Sawai H, et al. Rapid evolution of the male-specific antibacterial protein andropin gene in Drosophila. J Mol Evol. 2002;54(5):665-70. Published 2002 May. doi:10.1007/s00239-001-0062-5
PMID: 11965438
Citation 4: Adams MD, Celniker SE, Holt RA, et al. The genome sequence of Drosophila melanogaster. Science. 2000;287(5461):2185-95. Published 2000 Mar 24. doi:10.1126/science.287.5461.2185
PMID: 10731132
Citation 5: Misra S, Crosby MA, Mungall CJ, et al. Annotation of the Drosophila melanogaster euchromatic genome: a systematic review. Genome Biol. 2002;3(12):RESEARCH0083. Published 2002. doi:10.1186/gb-2002-3-12-research0083
PMID: 12537572
Citation 6: Ramos-Onsins S, Aguadé M, Aguadé M. Molecular evolution of the Cecropin multigene family in Drosophila. functional genes vs. pseudogenes. Genetics. 1998;150(1):157-71. Published 1998 Sep. doi:10.1093/genetics/150.1.157
PMID: 9725836
5.2 Protein Sequence Databases
UniProt: P21663
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P21663
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. X16972 GenBank || EMBL
2. X56726 GenBank || EMBL
3. AF018985 GenBank || EMBL
4. AF018986 GenBank || EMBL
5. AF018987 GenBank || EMBL
6. AF018988 GenBank || EMBL
7. AF018989 GenBank || EMBL
8. AF018990 GenBank || EMBL
9. AF018991 GenBank || EMBL
10. AF018992 GenBank || EMBL
11. AB047046 GenBank || EMBL
12. AB047047 GenBank || EMBL
13. AB047048 GenBank || EMBL
14. AB047049 GenBank || EMBL
15. AB047050 GenBank || EMBL
16. AE014297 GenBank || EMBL
17. BT031308 GenBank || EMBL
18. Y16852 GenBank || EMBL
19. Y16853 GenBank || EMBL
20. Y16854 GenBank || EMBL
21. Y16855 GenBank || EMBL
22. Y16856 GenBank || EMBL
23. Y16857 GenBank || EMBL
24. Y16858 GenBank || EMBL
25. Y16859 GenBank || EMBL
26. Y16861 GenBank || EMBL
CCDS: Not found
RefSeq: NP_001287605.1, NP_524587.1
5.5 Protein-Protein Interaction Databases
STRING: 7227.FBpp0084976
IntAct: P21663
MINT: Not found
DIP: DIP-21373N
BioGRID: 68451
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR000875
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: dme:Dmel_CG1361
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India