AMPDB_702 | Cecropin-P1

1 General Description

AMPDB ID: AMPDB_702

Protein Names: Cecropin-P1

Protein Family: Cecropin family

Gene Name: ASCEC-1

Source Organism: Ascaris suum (Pig roundworm) (Ascaris lumbricoides)

Protein Length: 70 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MFLIYLFVQTAESSWLSKTAKKLENSAKKRISEGIAIAIQGGPRRRRFVAEQDAIHSRVSREVPTLSDSV

FASTA format

Counts of Amino Acids

'A': 7, 'R': 7, 'N': 1, 'D': 2, 'C': 0, 'Q': 3, 'E': 5, 'G': 3, 'H': 1, 'I': 6, 'L': 5, 'K': 5, 'M': 1, 'F': 3, 'P': 2, 'S': 9, 'T': 3, 'W': 1, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 10%, 'R': 10%, 'N': 1.43%, 'D': 2.86%, 'C': 0%, 'Q': 4.29%, 'E': 7.14%, 'G': 4.29%, 'H': 1.43%, 'I': 8.57%, 'L': 7.14%, 'K': 7.14%, 'M': 1.43%, 'F': 4.29%, 'P': 2.86%, 'S': 12.86%, 'T': 4.29%, 'W': 1.43%, 'Y': 1.43%, 'V': 7.14%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M, N, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7876.08 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	65.611	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.267	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.674	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.953	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.096	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.3, 0.214, 0.257 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.071	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Pillai A, Ueno S, Zhang H, et al. Cecropin P1 and novel nematode cecropins: a bacteria-inducible antimicrobial peptide family in the nematode Ascaris suum. Biochem J. 2005;390(Pt 1):207-14. Published 2005 Aug 15. doi:10.1042/BJ20050218

PMID: 15850460

Citation 2: Lee JY, Boman A, Sun CX, et al. Antibacterial peptides from pig intestine: isolation of a mammalian cecropin. Proc Natl Acad Sci U S A. 1989;86(23):9159-62. Published 1989 Dec. doi:10.1073/pnas.86.23.9159

PMID: 2512577

Citation 3: Andersson M, Boman A, Boman HG, et al. Ascaris nematodes from pig and human make three antibacterial peptides: isolation of cecropin P1 and two ASABF peptides. Cell Mol Life Sci. 2003;60(3):599-606. Published 2003 Mar. doi:10.1007/s000180300051

PMID: 12737319

Citation 4: Sipos D, Andersson M, Ehrenberg A, et al. The structure of the mammalian antibacterial peptide cecropin P1 in solution, determined by proton-NMR. Eur J Biochem. 1992;209(1):163-9. Published 1992 Oct 1. doi:10.1111/j.1432-1033.1992.tb17273.x

PMID: 1396696

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P14661

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB186032	GenBank \|\| EMBL
2.	AB186036	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875

PANTHER: Not found

PROSITE: PS00268

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download