AMPDB_701 | Tachyplesin-1

1 General Description

AMPDB ID: AMPDB_701

Protein Names: Tachyplesin-1 (Tachyplesin I)

Protein Family: Tachyplesin polyphemusin family

Gene Name: Nil

Source Organism: Tachypleus tridentatus (Japanese horseshoe crab)

Protein Length: 77 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKKLVIALCLMMVLAVMVEEAEAKWCFRVCYRGICYRRCRGKRNEVRQYRDRGYDVRAIPEETFFTRQDEDEDDDEE

FASTA format

Counts of Amino Acids

'A': 5, 'R': 11, 'N': 1, 'D': 7, 'C': 5, 'Q': 2, 'E': 10, 'G': 3, 'H': 0, 'I': 3, 'L': 4, 'K': 4, 'M': 4, 'F': 3, 'P': 1, 'S': 0, 'T': 2, 'W': 1, 'Y': 4, 'V': 7

Frequencies of Amino Acids

'A': 6.49%, 'R': 14.29%, 'N': 1.3%, 'D': 9.09%, 'C': 6.49%, 'Q': 2.6%, 'E': 12.99%, 'G': 3.9%, 'H': 0%, 'I': 3.9%, 'L': 5.19%, 'K': 5.19%, 'M': 5.19%, 'F': 3.9%, 'P': 1.3%, 'S': 0%, 'T': 2.6%, 'W': 1.3%, 'Y': 5.19%, 'V': 9.09%

Missing Amino Acid(s)

H, S

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

N, P, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9348.75 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.312	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.777	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.647	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.665	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.912	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.296	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.286, 0.065, 0.299 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.104	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11460, 11710	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Shigenaga T, Muta T, Toh Y, et al. Antimicrobial tachyplesin peptide precursor. cDNA cloning and cellular localization in the horseshoe crab (Tachypleus tridentatus). J Biol Chem. 1990;265(34):21350-4. Published 1990 Dec 5. doi:

PMID: 2250028

Citation 2: Nakamura T, Furunaka H, Miyata T, et al. Tachyplesin, a class of antimicrobial peptide from the hemocytes of the horseshoe crab (Tachypleus tridentatus). Isolation and chemical structure. J Biol Chem. 1988;263(32):16709-13. Published 1988 Nov 15. doi:

PMID: 3141410

Citation 3: Kawano K, Yoneya T, Miyata T, et al. Antimicrobial peptide, tachyplesin I, isolated from hemocytes of the horseshoe crab (Tachypleus tridentatus). NMR determination of the beta-sheet structure. J Biol Chem. 1990;265(26):15365-7. Published 1990 Sep 15. doi:

PMID: 2394727

Citation 4: Tamamura H, Kuroda M, Masuda M, et al. A comparative study of the solution structures of tachyplesin I and a novel anti-HIV synthetic peptide, T22 ([Tyr5,12, Lys7]-polyphemusin II), determined by nuclear magnetic resonance. Biochim Biophys Acta. 1993;1163(2):209-16. Published 1993 May 13. doi:10.1016/0167-4838(93)90183-r

PMID: 8490053

Citation 5: Shigenaga T, Takayenoki Y, Kawasaki S, et al. Separation of large and small granules from horseshoe crab (Tachypleus tridentatus) hemocytes and characterization of their components. J Biochem. 1993;114(3):307-16. Published 1993 Sep. doi:10.1093/oxfordjournals.jbchem.a124173

PMID: 8282718

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P14213

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M57242	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download