AMPDB_699 | Lantibiotic nisin-A

1 General Description

AMPDB ID: AMPDB_699

Protein Names: Lantibiotic nisin-A

Protein Family: Type A lantibiotic family

Gene Name: spaN nisA

Source Organism: Lactococcus lactis subsp. lactis (Streptococcus lactis)

Protein Length: 57 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNMKTATCHCSIHVSK

FASTA format

Counts of Amino Acids

'A': 3, 'R': 1, 'N': 2, 'D': 3, 'C': 5, 'Q': 0, 'E': 0, 'G': 4, 'H': 2, 'I': 3, 'L': 4, 'K': 6, 'M': 3, 'F': 1, 'P': 2, 'S': 9, 'T': 6, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 5.26%, 'R': 1.75%, 'N': 3.51%, 'D': 5.26%, 'C': 8.77%, 'Q': 0%, 'E': 0%, 'G': 7.02%, 'H': 3.51%, 'I': 5.26%, 'L': 7.02%, 'K': 10.53%, 'M': 5.26%, 'F': 1.75%, 'P': 3.51%, 'S': 15.79%, 'T': 10.53%, 'W': 0%, 'Y': 0%, 'V': 5.26%

Missing Amino Acid(s)

E, Q, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5962.98 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.421	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.111	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.005	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.313	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.802	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.869	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.193, 0.298, 0.175 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.018	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 250	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Buchman GW, Banerjee S, Hansen JN, et al. Structure, expression, and evolution of a gene encoding the precursor of nisin, a small protein antibiotic. J Biol Chem. 1988;263(31):16260-6. Published 1988 Nov 5. doi:

PMID: 3141403

Citation 2: Steen MT, Chung YJ, Hansen JN, et al. Characterization of the nisin gene as part of a polycistronic operon in the chromosome of Lactococcus lactis ATCC 11454. Appl Environ Microbiol. 1991;57(4):1181-8. Published 1991 Apr. doi:10.1128/aem.57.4.1181-1188.1991

PMID: 1905517

Citation 3: Kaletta C, Entian KD, Entian KD. Nisin, a peptide antibiotic: cloning and sequencing of the nisA gene and posttranslational processing of its peptide product. J Bacteriol. 1989;171(3):1597-601. Published 1989 Mar. doi:10.1128/jb.171.3.1597-1601.1989

PMID: 2493449

Citation 4: Engelke G, Gutowski-Eckel Z, Hammelmann M, et al. Biosynthesis of the lantibiotic nisin: genomic organization and membrane localization of the NisB protein. Appl Environ Microbiol. 1992;58(11):3730-43. Published 1992 Nov. doi:10.1128/aem.58.11.3730-3743.1992

PMID: 1482192

Citation 5: Kuipers OP, Beerthuyzen MM, Siezen RJ, et al. Characterization of the nisin gene cluster nisABTCIPR of Lactococcus lactis. Requirement of expression of the nisA and nisI genes for development of immunity. Eur J Biochem. 1993;216(1):281-91. Published 1993 Aug 15. doi:10.1111/j.1432-1033.1993.tb18143.x

PMID: 7689965

Citation 6: Gross E, Morell JL, Morell JL. The structure of nisin. J Am Chem Soc. 1971;93(18):4634-5. Published 1971 Sep 8. doi:10.1021/ja00747a073

PMID: 5131162

Citation 7: Van de Ven FJ, Van den Hooven HW, Konings RN, et al. NMR studies of lantibiotics. The structure of nisin in aqueous solution. Eur J Biochem. 1991;202(3):1181-8. Published 1991 Dec 18. doi:10.1111/j.1432-1033.1991.tb16488.x

PMID: 1765078

Citation 8: Lian LY, Chan WC, Morley SD, et al. Solution structures of nisin A and its two major degradation products determined by n.m.r. Biochem J. 1992;283 ( Pt 2)(Pt 2):413-20. Published 1992 Apr 15. doi:10.1042/bj2830413

PMID: 1575686

Citation 9: van den Hooven HW, Fogolari F, Rollema HS, et al. NMR and circular dichroism studies of the lantibiotic nisin in non-aqueous environments. FEBS Lett. 1993;319(1-2):189-94. Published 1993 Mar 15. doi:10.1016/0014-5793(93)80065-3

PMID: 8454055

Citation 10: Sailer M, Helms GL, Henkel T, et al. 15N- and 13C-labeled media from Anabaena sp. for universal isotopic labeling of bacteriocins: NMR resonance assignments of leucocin A from Leuconostoc gelidum and nisin A from Lactococcus lactis. Biochemistry. 1993;32(1):310-8. Published 1993 Jan 12. doi:10.1021/bi00052a039

PMID: 8418850

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P13068

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	J04057	GenBank \|\| EMBL
2.	M65089	GenBank \|\| EMBL
3.	M24527	GenBank \|\| EMBL
4.	X68307	GenBank \|\| EMBL
5.	M27277	GenBank \|\| EMBL
6.	D00696	GenBank \|\| EMBL
7.	L16226	GenBank \|\| EMBL
8.	M79445	GenBank \|\| EMBL

RefSeq: WP_014570405.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006079

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download