AMPDB_698 | Protein NP24

PEPTIDE SUMMARY

Protein NP24

1 General Description

AMPDB ID: AMPDB_698

Protein Names: Protein NP24 (Pathogenesis-related protein PR P23) (Salt-induced protein)

Protein Family: Thaumatin family

Gene Name: Nil

Source Organism: Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Protein Length: 247 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MGYLTSSFVLFFLLCVTYTYAATIEVRNNCPYTVWAASTPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYALDQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPDAYSYPQDDPTSTFTCPGGSTNYRVVFCPNGVADPNFPLEMPASTDEVAK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 18, 'R': 11, 'N': 16, 'D': 10, 'C': 17, 'Q': 8, 'E': 6, 'G': 28, 'H': 2, 'I': 8, 'L': 13, 'K': 9, 'M': 4, 'F': 14, 'P': 21, 'S': 11, 'T': 25, 'W': 5, 'Y': 9, 'V': 12

Frequencies of Amino Acids

'A': 7.29%, 'R': 4.45%, 'N': 6.48%, 'D': 4.05%, 'C': 6.88%, 'Q': 3.24%, 'E': 2.43%, 'G': 11.34%, 'H': 0.81%, 'I': 3.24%, 'L': 5.26%, 'K': 3.64%, 'M': 1.62%, 'F': 5.67%, 'P': 8.5%, 'S': 4.45%, 'T': 10.12%, 'W': 2.02%, 'Y': 3.64%, 'V': 4.86%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

123

Hydrophilic Amino Acid(s) Count

124

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	26646.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	54.534	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	35.517	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.246	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.705	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.96	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.131	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.247, 0.308, 0.166 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.113	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	40910, 41910	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

P.betae

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Plant defense

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Rodrigo I, Vera P, Frank R, et al. Identification of the viroid-induced tomato pathogenesis-related (PR) protein P23 as the thaumatin-like tomato protein NP24 associated with osmotic stress. Plant Mol Biol. 1991;16(5):931-4. Published 1991 May. doi:10.1007/BF00015088

PMID: 1859873

Citation 2: Pressey R, Pressey R. Two isoforms of NP24: a thaumatin-like protein in tomato fruit. Phytochemistry. 1997;44(7):1241-5. Published 1997 Apr. doi:10.1016/s0031-9422(96)00667-x

PMID: 9115696

5.2 Protein Sequence Databases

UniProt: P12670

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P12670

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF093743	GenBank \|\| EMBL
2.	M21346	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001292922.1

5.5 Protein-Protein Interaction Databases

STRING: 4081.Solyc08g080640.1.1

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR037176, IPR001938, IPR017949

PANTHER: PTHR31048

PROSITE: PS00316, PS51367

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: sly:543979

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download