AMPDB_683 | Pumilarin

PEPTIDE SUMMARY

Pumilarin

1 General Description

AMPDB ID: AMPDB_683

Protein Names: Pumilarin (Circular bacteriocin) (Enterocin AS-48-like) (Head-to-tail cyclized peptide)

Protein Family: Nil

Gene Name: B4107_2383

Source Organism: Bacillus safensis

Protein Length: 108 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MTETKNEIKLHVLFGALAVGFLMLALFSFSLQMLPVADLAKEFGIPGSVAAVVLNVVEAGGAVTTIVSILTAVGSGGLSLIAAAGKETIRQYLKNEIKKKGRKAVIAW

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 15, 'R': 2, 'N': 3, 'D': 1, 'C': 0, 'Q': 2, 'E': 6, 'G': 11, 'H': 1, 'I': 8, 'L': 14, 'K': 9, 'M': 3, 'F': 5, 'P': 2, 'S': 6, 'T': 6, 'W': 1, 'Y': 1, 'V': 12

Frequencies of Amino Acids

'A': 13.89%, 'R': 1.85%, 'N': 2.78%, 'D': 0.93%, 'C': 0%, 'Q': 1.85%, 'E': 5.56%, 'G': 10.19%, 'H': 0.93%, 'I': 7.41%, 'L': 12.96%, 'K': 8.33%, 'M': 2.78%, 'F': 4.63%, 'P': 1.85%, 'S': 5.56%, 'T': 5.56%, 'W': 0.93%, 'Y': 0.93%, 'V': 11.11%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, H, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	11284.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	125.556	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	15.457	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.724	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.652	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.351	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.096	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.38, 0.204, 0.352 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.065	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cereus (Gram-positive), B.pumilus (Gram-positive), E.coli (Gram-negative), M.flavus (Not characterize), S.pneumoniae (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: de Jong A, van Heel AJ, Montalban-Lopez M, et al. Draft Genome Sequences of Five Spore-Forming Food Isolates of Bacillus pumilus. Genome Announc. 2015;3(2). Published 2015 Mar 12. doi:10.1128/genomeA.01539-14

PMID: 25767247

Citation 2: van Heel AJ, Montalban-Lopez M, Oliveau Q, et al. Genome-guided identification of novel head-to-tail cyclized antimicrobial peptides, exemplified by the discovery of pumilarin. Microb Genom. 2017;3(10):e000134. Published 2017 Oct. doi:10.1099/mgen.0.000134

PMID: 29177092

5.2 Protein Sequence Databases

UniProt: P0DTW2

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DTW2

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JXCK01000019	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_024423066.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR009086, IPR020038

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download