AMPDB_680 | M-poneratoxin-Dq3a

PEPTIDE SUMMARY

M-poneratoxin-Dq3a

1 General Description

AMPDB ID: AMPDB_680

Protein Names: M-poneratoxin-Dq3a (M-PONTX-Dq3a) (Dinoponeratoxin) (DnTx) (Peptide sDq-2561) (U-poneritoxin(01)-Dq6a) (PONTX(01)-Dq6) (U-PONTX(01)-Dq6a) [Cleaved into: M-poneratoxin-Dq3b (M-PONTX-Dq3b) (Peptide sDq-1503); M-poneratoxin-Dq3c (M-PONTX-Dq3c) (Peptide sDq-1319)]

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Medium-length antimicrobial peptide (group 3) family; Ponericin-W subfamily

Gene Name: Nil

Source Organism: Dinoponera quadriceps (South American ant)

Protein Length: 66 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MKLSALSIIFGMILVMTIMYTKAEAEAEAEADADADAKAEAEAFWGTLAKWALKAIPAAMGMKQNK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 17, 'R': 0, 'N': 1, 'D': 3, 'C': 0, 'Q': 1, 'E': 6, 'G': 3, 'H': 0, 'I': 5, 'L': 5, 'K': 7, 'M': 6, 'F': 2, 'P': 1, 'S': 2, 'T': 3, 'W': 2, 'Y': 1, 'V': 1

Frequencies of Amino Acids

'A': 25.76%, 'R': 0%, 'N': 1.52%, 'D': 4.55%, 'C': 0%, 'Q': 1.52%, 'E': 9.09%, 'G': 4.55%, 'H': 0%, 'I': 7.58%, 'L': 7.58%, 'K': 10.61%, 'M': 9.09%, 'F': 3.03%, 'P': 1.52%, 'S': 3.03%, 'T': 4.55%, 'W': 3.03%, 'Y': 1.52%, 'V': 1.52%

Missing Amino Acid(s)

C, H, R

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

N, P, Q, V, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7079.35 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	89.242	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	12.723	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.271	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.507	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.609	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.993	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.242, 0.106, 0.515 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.076	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12490	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Trypanosoma cruzi

4.2 Antimicrobial Activity

Antimicrobial, Anti-parasitic

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Torres AF, Huang C, Chong CM, et al. Transcriptome analysis in venom gland of the predatory giant ant Dinoponera quadriceps: insights into the polypeptide toxin arsenal of hymenopterans. PLoS One. 2014;9(1):e87556. Published 2014. doi:10.1371/journal.pone.0087556

PMID: 24498135

Citation 2: Lima DB, Mello CP, Bandeira ICJ, et al. The dinoponeratoxin peptides from the giant ant Dinoponera quadriceps display in vitro antitrypanosomal activity. Biol Chem. 2018;399(2):187-196. Published 2018 Jan 26. doi:10.1515/hsz-2017-0198

PMID: 28976889

Citation 3: Robinson SD, Mueller A, Clayton D, et al. A comprehensive portrait of the venom of the giant red bull ant, Myrmecia gulosa, reveals a hyperdiverse hymenopteran toxin gene family. Sci Adv. 2018;4(9):eaau4640. Published 2018 Sep. doi:10.1126/sciadv.aau4640

PMID: 30214940

5.2 Protein Sequence Databases

UniProt: P0DSK0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DSK0

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012523

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download