AMPDB_678 | Defensin BmKDfsin4

PEPTIDE SUMMARY

Defensin BmKDfsin4

1 General Description

AMPDB ID: AMPDB_678

Protein Names: Defensin BmKDfsin4 (4 kDa defensin)

Protein Family: Invertebrate defensin family; Type 2 subfamily

Gene Name: Nil

Source Organism: Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)

Protein Length: 62 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTIVLLFVLALVFCTLEMGIVEAGFGCPFNQGQCHKHCQSIRRRGGYCDGFLKQRCVCYRK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 5, 'N': 1, 'D': 1, 'C': 7, 'Q': 4, 'E': 2, 'G': 7, 'H': 2, 'I': 3, 'L': 6, 'K': 4, 'M': 2, 'F': 5, 'P': 1, 'S': 1, 'T': 2, 'W': 0, 'Y': 2, 'V': 5

Frequencies of Amino Acids

'A': 3.23%, 'R': 8.06%, 'N': 1.61%, 'D': 1.61%, 'C': 11.29%, 'Q': 6.45%, 'E': 3.23%, 'G': 11.29%, 'H': 3.23%, 'I': 4.84%, 'L': 9.68%, 'K': 6.45%, 'M': 3.23%, 'F': 8.06%, 'P': 1.61%, 'S': 1.61%, 'T': 3.23%, 'W': 0%, 'Y': 3.23%, 'V': 8.06%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

C, G

Less Occurring Amino Acid(s)

D, N, P, S

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7074.49 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	83.226	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.06	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.234	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.577	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.94	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.747	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.339, 0.161, 0.194 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.113	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), Hepatitis B, M.luteus (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-MRSA, Anti-hepatities, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Cao Z, Yu Y, Wu Y, et al. The genome of Mesobuthus martensii reveals a unique adaptation model of arthropods. Nat Commun. 2013;4:2602. Published 2013. doi:10.1038/ncomms3602

PMID: 24129506

Citation 2: Meng L, Xie Z, Zhang Q, et al. Scorpion Potassium Channel-blocking Defensin Highlights a Functional Link with Neurotoxin. J Biol Chem. 2016;291(13):7097-106. Published 2016 Mar 25. doi:10.1074/jbc.M115.680611

PMID: 26817841

Citation 3: Zeng Z, Zhang Q, Hong W, et al. A Scorpion Defensin BmKDfsin4 Inhibits Hepatitis B Virus Replication in Vitro. Toxins (Basel). 2016;8(5). Published 2016 Apr 27. doi:10.3390/toxins8050124

PMID: 27128943

5.2 Protein Sequence Databases

UniProt: P0DQT9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DQT9

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download