AMPDB_677 | Stigmurin

1 General Description

AMPDB ID: AMPDB_677

Protein Names: Stigmurin

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Tityus stigmurus (Brazilian scorpion)

Protein Length: 73 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MQIKHLITLFFLVLIVADQCSAFFSLIPSLVGGLISAFKGRRKREISAQIEQYKDLQKREAELEKLLDRLPMY

FASTA format

Counts of Amino Acids

'A': 5, 'R': 5, 'N': 0, 'D': 3, 'C': 1, 'Q': 5, 'E': 5, 'G': 3, 'H': 1, 'I': 7, 'L': 12, 'K': 6, 'M': 2, 'F': 5, 'P': 2, 'S': 5, 'T': 1, 'W': 0, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 6.85%, 'R': 6.85%, 'N': 0%, 'D': 4.11%, 'C': 1.37%, 'Q': 6.85%, 'E': 6.85%, 'G': 4.11%, 'H': 1.37%, 'I': 9.59%, 'L': 16.44%, 'K': 8.22%, 'M': 2.74%, 'F': 6.85%, 'P': 2.74%, 'S': 6.85%, 'T': 1.37%, 'W': 0%, 'Y': 2.74%, 'V': 4.11%

Missing Amino Acid(s)

N, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, H, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8469.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	120.274	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.018	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.174	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.611	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.751	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.034	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.397, 0.137, 0.329 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.096	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 2980	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

C.albicans, C.glabrata, S.aureus (Gram-positive), S.epidermidis (Gram-positive), Trypanosoma cruzi

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-MRSA, Anti-candida, Anti-parasitic, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: de Melo ET, Estrela AB, Santos EC, et al. Structural characterization of a novel peptide with antimicrobial activity from the venom gland of the scorpion Tityus stigmurus: Stigmurin. Peptides. 2015;68:3-10. Published 2015 Jun. doi:10.1016/j.peptides.2015.03.003

PMID: 25805002

Citation 2: Daniele-Silva A, Machado RJ, Monteiro NK, et al. Stigmurin and TsAP-2 from Tityus stigmurus scorpion venom: Assessment of structure and therapeutic potential in experimental sepsis. Toxicon. 2016;121:10-21. Published 2016 Oct. doi:10.1016/j.toxicon.2016.08.016

PMID: 27567704

Citation 3: Parente AMS, Daniele-Silva A, Furtado AA, et al. Analogs of the Scorpion Venom Peptide Stigmurin: Structural Assessment, Toxicity, and Increased Antimicrobial Activity. Toxins (Basel). 2018;10(4). Published 2018 Apr 18. doi:10.3390/toxins10040161

PMID: 29670004

Citation 4: Amorim-Carmo B, Daniele-Silva A, Parente AMS, et al. Potent and Broad-Spectrum Antimicrobial Activity of Analogs from the Scorpion Peptide Stigmurin. Int J Mol Sci. 2019;20(3). Published 2019 Jan 31. doi:10.3390/ijms20030623

PMID: 30709056

Citation 5: Daniele-Silva A, Rodrigues SCS, Dos Santos ECG, et al. NMR three-dimensional structure of the cationic peptide Stigmurin from Tityus stigmurus scorpion venom: In vitro antioxidant and in vivo antibacterial and healing activity. Peptides. 2021;137:170478. Published 2021 Mar. doi:10.1016/j.peptides.2020.170478

PMID: 33359395

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P0DQT1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JK483709	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download