AMPDB_674 | Capistruin

1 General Description

AMPDB ID: AMPDB_674

Protein Names: Capistruin (Cap) (Class II lasso peptide) (Lariat peptide) (Ribosomally synthesized and post-translationally modified peptide) (RiPP)

Protein Family: Nil

Gene Name: CapA BTH_I2437.1

Source Organism: Burkholderia thailandensis (strain ATCC 700388 DSM 13276 CIP 106301 E264)

Protein Length: 47 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MVRLLAKLLRSTIHGSNGVSLDAVSSTHGTPGFQTPDARVISRFGFN

FASTA format

Counts of Amino Acids

'A': 3, 'R': 4, 'N': 2, 'D': 2, 'C': 0, 'Q': 1, 'E': 0, 'G': 5, 'H': 2, 'I': 2, 'L': 5, 'K': 1, 'M': 1, 'F': 3, 'P': 2, 'S': 6, 'T': 4, 'W': 0, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 6.38%, 'R': 8.51%, 'N': 4.26%, 'D': 4.26%, 'C': 0%, 'Q': 2.13%, 'E': 0%, 'G': 10.64%, 'H': 4.26%, 'I': 4.26%, 'L': 10.64%, 'K': 2.13%, 'M': 2.13%, 'F': 6.38%, 'P': 4.26%, 'S': 12.77%, 'T': 8.51%, 'W': 0%, 'Y': 0%, 'V': 8.51%

Missing Amino Acid(s)

C, E, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

K, M, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5012.72 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	89.149	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	21.228	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.04	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.834	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	12.053	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.18	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.298, 0.319, 0.191 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.064	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Burkholderia (Gram-negative), Pseudomonas (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Kim HS, Schell MA, Yu Y, et al. Bacterial genome adaptation to niches: divergence of the potential virulence genes in three Burkholderia species of different survival strategies. BMC Genomics. 2005;6:174. Published 2005 Dec 7. doi:10.1186/1471-2164-6-174

PMID: 16336651

Citation 2: Knappe TA, Linne U, Zirah S, et al. Isolation and structural characterization of capistruin, a lasso peptide predicted from the genome sequence of Burkholderia thailandensis E264. J Am Chem Soc. 2008;130(34):11446-54. Published 2008 Aug 27. doi:10.1021/ja802966g

PMID: 18671394

Citation 3: Knappe TA, Linne U, Robbel L, et al. Insights into the biosynthesis and stability of the lasso peptide capistruin. Chem Biol. 2009;16(12):1290-8. Published 2009 Dec 24. doi:10.1016/j.chembiol.2009.11.009

PMID: 20064439

Citation 4: Kuznedelov K, Semenova E, Knappe TA, et al. The antibacterial threaded-lasso peptide capistruin inhibits bacterial RNA polymerase. J Mol Biol. 2011;412(5):842-8. Published 2011 Oct 7. doi:10.1016/j.jmb.2011.02.060

PMID: 21396375

Citation 5: Braffman NR, Piscotta FJ, Hauver J, et al. Structural mechanism of transcription inhibition by lasso peptides microcin J25 and capistruin. Proc Natl Acad Sci U S A. 2019;116(4):1273-1278. Published 2019 Jan 22. doi:10.1073/pnas.1817352116

PMID: 30626643

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P0DQM5

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	CP000086	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download