AMPDB_67 | Basic phospholipase A2 homolog 2

PEPTIDE SUMMARY

Basic phospholipase A2 homolog 2

1 General Description

AMPDB ID: AMPDB_67

Protein Names: Basic phospholipase A2 homolog 2 (svPLA2 homolog) (Myotoxin II) (MTX-II)

Protein Family: Phospholipase A2 family; Group II subfamily; K49 sub-subfamily

Gene Name: Nil

Source Organism: Bothrops brazili (Brazil`s lancehead)

Protein Length: 121 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

SLFQLGKMILQETGKNPAASYGAYGCNCGVLGRGKPKDATDRCCYVHKCCKKKLTGCDPKKDRYSYSWKDKTIVCGENNPCLKELCECDKAVAICLRENLNTYNKKYRYHLKPFCKKADPC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 5, 'N': 7, 'D': 7, 'C': 14, 'Q': 2, 'E': 5, 'G': 9, 'H': 2, 'I': 3, 'L': 10, 'K': 19, 'M': 1, 'F': 2, 'P': 6, 'S': 4, 'T': 5, 'W': 1, 'Y': 8, 'V': 4

Frequencies of Amino Acids

'A': 5.79%, 'R': 4.13%, 'N': 5.79%, 'D': 5.79%, 'C': 11.57%, 'Q': 1.65%, 'E': 4.13%, 'G': 7.44%, 'H': 1.65%, 'I': 2.48%, 'L': 8.26%, 'K': 15.7%, 'M': 0.83%, 'F': 1.65%, 'P': 4.96%, 'S': 3.31%, 'T': 4.13%, 'W': 0.83%, 'Y': 6.61%, 'V': 3.31%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	13691 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	57.273	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	18.549	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.697	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.522	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.972	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	11.312	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.231, 0.215, 0.19 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.091	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	17420, 18295	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), Leishmania

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-candida, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Costa TR, Menaldo DL, Oliveira CZ, et al. Myotoxic phospholipases A(2) isolated from Bothrops brazili snake venom and synthetic peptides derived from their C-terminal region: cytotoxic effect on microorganism and tumor cells. Peptides. 2008;29(10):1645-56. Published 2008 Oct. doi:10.1016/j.peptides.2008.05.021

PMID: 18602430

Citation 2: Ullah A, Souza TA, Betzel C, et al. Crystallographic portrayal of different conformational states of a Lys49 phospholipase Aâ homologue: insights into structural determinants for myotoxicity and dimeric configuration. Int J Biol Macromol. 2012;51(3):209-14. Published 2012 Oct. doi:10.1016/j.ijbiomac.2012.05.006

PMID: 22584077

Citation 3: Fernandes CA, Comparetti EJ, Borges RJ, et al. Structural bases for a complete myotoxic mechanism: crystal structures of two non-catalytic phospholipases A2-like from Bothrops brazili venom. Biochim Biophys Acta. 2013;1834(12):2772-81. Published 2013 Dec. doi:10.1016/j.bbapap.2013.10.009

PMID: 24145104

5.2 Protein Sequence Databases

UniProt: I6L8L6

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: I6L8L6

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001211, IPR033112, IPR016090, IPR036444, IPR033113

PANTHER: PTHR11716

PROSITE: PS00119, PS00118

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download