AMPDB_665 | Im-1

PEPTIDE SUMMARY

Im-1

1 General Description

AMPDB ID: AMPDB_665

Protein Names: Im-1 (Non-disulfide-bridged peptide 2.6) (NDBP-2.6)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Long chain multifunctional peptide (group 2) family

Gene Name: Nil

Source Organism: Isometrus maculatus (Lesser brown scorpion) (Scorpio maculatus)

Protein Length: 56 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

FSFKRLKGFAKKLWNSKLARKIRTKGLKYVKNFAKDMLSEGEEAPPAAEPPVEAPQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 3, 'N': 2, 'D': 1, 'C': 0, 'Q': 1, 'E': 5, 'G': 3, 'H': 0, 'I': 1, 'L': 5, 'K': 10, 'M': 1, 'F': 4, 'P': 5, 'S': 3, 'T': 1, 'W': 1, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 12.5%, 'R': 5.36%, 'N': 3.57%, 'D': 1.79%, 'C': 0%, 'Q': 1.79%, 'E': 8.93%, 'G': 5.36%, 'H': 0%, 'I': 1.79%, 'L': 8.93%, 'K': 17.86%, 'M': 1.79%, 'F': 7.14%, 'P': 8.93%, 'S': 5.36%, 'T': 1.79%, 'W': 1.79%, 'Y': 1.79%, 'V': 3.57%

Missing Amino Acid(s)

C, H

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, I, M, Q, T, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6348.46 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	64.643	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	41.009	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.73	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.724	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.818	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.004	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.25, 0.232, 0.321 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.107	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 6990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Cytolytic, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Miyashita M, Sakai A, Matsushita N, et al. A novel amphipathic linear peptide with both insect toxicity and antimicrobial activity from the venom of the scorpion Isometrus maculatus. Biosci Biotechnol Biochem. 2010;74(2):364-9. Published 2010. doi:10.1271/bbb.90723

PMID: 20139620

Citation 2: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

UniProt: P0CF38

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0CF38

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download