AMPDB_664 | Defensin-like turtle egg white protein TEWP

PEPTIDE SUMMARY

Defensin-like turtle egg white protein TEWP

1 General Description

AMPDB ID: AMPDB_664

Protein Names: Defensin-like turtle egg white protein TEWP (TEWP)

Protein Family: Beta-defensin family

Gene Name: Nil

Source Organism: Caretta caretta (Loggerhead sea turtle)

Protein Length: 36 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 2, 'N': 1, 'D': 0, 'C': 6, 'Q': 1, 'E': 1, 'G': 3, 'H': 1, 'I': 1, 'L': 2, 'K': 7, 'M': 0, 'F': 0, 'P': 4, 'S': 0, 'T': 2, 'W': 0, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 0%, 'R': 5.56%, 'N': 2.78%, 'D': 0%, 'C': 16.67%, 'Q': 2.78%, 'E': 2.78%, 'G': 8.33%, 'H': 2.78%, 'I': 2.78%, 'L': 5.56%, 'K': 19.44%, 'M': 0%, 'F': 0%, 'P': 11.11%, 'S': 0%, 'T': 5.56%, 'W': 0%, 'Y': 5.56%, 'V': 8.33%

Missing Amino Acid(s)

A, D, F, M, S, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, H, I, N, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4079.99 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	56.667	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.6	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.608	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.518	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.812	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.715	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.222, 0.222, 0.083 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.056	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Chandipura, E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Chattopadhyay S, Sinha NK, Banerjee S, et al. Small cationic protein from a marine turtle has beta-defensin-like fold and antibacterial and antiviral activity. Proteins. 2006;64(2):524-31. Published 2006 Aug 1. doi:10.1002/prot.20963

PMID: 16700051

5.2 Protein Sequence Databases

UniProt: P0CAP0

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P0CAP0

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download