AMPDB_660 | Brevinin-1DYb

PEPTIDE SUMMARY

Brevinin-1DYb

1 General Description

AMPDB ID: AMPDB_660

Protein Names: Brevinin-1DYb (Brevinin-1CDYb)

Protein Family: Frog skin active peptide (FSAP) family; Brevinin subfamily

Gene Name: Nil

Source Organism: Rana dybowskii (Dybovsky`s frog) (Korean brown frog)

Protein Length: 66 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTLKKSLLLLFFLGTISLSLCEEERNAEEERRDYPEERDVEVEKRFLSLALAALPKLFCLIFKKC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 5, 'N': 1, 'D': 2, 'C': 3, 'Q': 0, 'E': 10, 'G': 1, 'H': 0, 'I': 2, 'L': 14, 'K': 6, 'M': 1, 'F': 6, 'P': 2, 'S': 4, 'T': 2, 'W': 0, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 6.06%, 'R': 7.58%, 'N': 1.52%, 'D': 3.03%, 'C': 4.55%, 'Q': 0%, 'E': 15.15%, 'G': 1.52%, 'H': 0%, 'I': 3.03%, 'L': 21.21%, 'K': 9.09%, 'M': 1.52%, 'F': 9.09%, 'P': 3.03%, 'S': 6.06%, 'T': 3.03%, 'W': 0%, 'Y': 1.52%, 'V': 3.03%

Missing Amino Acid(s)

H, Q, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

G, M, N, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7785.22 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	109.394	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	54.236	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.047	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.563	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.126	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.172	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.379, 0.121, 0.439 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.106	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1615	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Jin LL, Li Q, Song SS, et al. Characterization of antimicrobial peptides isolated from the skin of the Chinese frog, Rana dybowskii. Comp Biochem Physiol B Biochem Mol Biol. 2009;154(2):174-8. Published 2009 Oct. doi:10.1016/j.cbpb.2009.05.015

PMID: 19539775

Citation 2: Conlon JM, Kolodziejek J, Nowotny N, et al. Cytolytic peptides belonging to the brevinin-1 and brevinin-2 families isolated from the skin of the Japanese brown frog, Rana dybowskii. Toxicon. 2007;50(6):746-56. Published 2007 Nov. doi:10.1016/j.toxicon.2007.06.023

PMID: 17688900

5.2 Protein Sequence Databases

UniProt: P0C5W7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0C5W7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU827799	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012520, IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download