AMPDB_655 | Ardiscretin

PEPTIDE SUMMARY

Ardiscretin

1 General Description

AMPDB ID: AMPDB_655

Protein Names: Ardiscretin (PT-Arthr-beta* NaTx2.1) (Toxin TdNa4)

Protein Family: Long (4 C-C) scorpion toxin superfamily; Sodium channel inhibitor family; Beta subfamily

Gene Name: Nil

Source Organism: Tityus discrepans (Venezuelan scorpion)

Protein Length: 83 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKGMIMLISCLMLIDVVVESKNGYIIEPKGCKYSCFWGSSTWCNRECKFKKGSSGYCAWPACWCYGLPDNVKIFDYYNNKCGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 1, 'N': 5, 'D': 3, 'C': 9, 'Q': 0, 'E': 3, 'G': 8, 'H': 0, 'I': 6, 'L': 4, 'K': 10, 'M': 4, 'F': 3, 'P': 3, 'S': 7, 'T': 1, 'W': 4, 'Y': 6, 'V': 4

Frequencies of Amino Acids

'A': 2.41%, 'R': 1.2%, 'N': 6.02%, 'D': 3.61%, 'C': 10.84%, 'Q': 0%, 'E': 3.61%, 'G': 9.64%, 'H': 0%, 'I': 7.23%, 'L': 4.82%, 'K': 12.05%, 'M': 4.82%, 'F': 3.61%, 'P': 3.61%, 'S': 8.43%, 'T': 1.2%, 'W': 4.82%, 'Y': 7.23%, 'V': 4.82%

Missing Amino Acid(s)

H, Q

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

R, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9506.23 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	63.374	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.419	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.08	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.401	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.477	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.439	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.325, 0.277, 0.157 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.157	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	30940, 31440	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: D'Suze G, Sevcik C, Corona M, et al. Ardiscretin a novel arthropod-selective toxin from Tityus discrepans scorpion venom. Toxicon. 2004;43(3):263-72. Published 2004 Mar 1. doi:10.1016/j.toxicon.2003.12.004

PMID: 15033324

Citation 2: D'Suze G, Schwartz EF, GarcÃa-GÃ³mez BI, et al. Molecular cloning and nucleotide sequence analysis of genes from a cDNA library of the scorpion Tityus discrepans. Biochimie. 2009;91(8):1010-9. Published 2009 Aug. doi:10.1016/j.biochi.2009.05.005

PMID: 19470401

Citation 3: Batista CV, D'Suze G, GÃ³mez-Lagunas F, et al. Proteomic analysis of Tityus discrepans scorpion venom and amino acid sequence of novel toxins. Proteomics. 2006;6(12):3718-27. Published 2006 Jun. doi:10.1002/pmic.200500525

PMID: 16705749

Citation 4: Guerrero-Vargas JA, MourÃ£o CB, Quintero-HernÃ¡ndez V, et al. Identification and phylogenetic analysis of Tityus pachyurus and Tityus obscurus novel putative Na+-channel scorpion toxins. PLoS One. 2012;7(2):e30478. Published 2012. doi:10.1371/journal.pone.0030478

PMID: 22355312

5.2 Protein Sequence Databases

UniProt: P0C1X7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0C1X7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FN392272	GenBank \|\| EMBL
2.	FN392280	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR044062, IPR003614, IPR036574, IPR018218, IPR002061

PANTHER: Not found

PROSITE: PS51863

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download