AMPDB_651 | Lantibiotic epidermin

PEPTIDE SUMMARY

Lantibiotic epidermin

1 General Description

AMPDB ID: AMPDB_651

Protein Names: Lantibiotic epidermin

Protein Family: Type A lantibiotic family

Gene Name: epiA

Source Organism: Staphylococcus epidermidis

Protein Length: 52 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MEAVKEKNDLFNLDVKVNAKESNDSGAEPRIASKFICTPGCAKTGSFNSYCC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 1, 'N': 5, 'D': 3, 'C': 4, 'Q': 0, 'E': 4, 'G': 3, 'H': 0, 'I': 2, 'L': 2, 'K': 6, 'M': 1, 'F': 3, 'P': 2, 'S': 5, 'T': 2, 'W': 0, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 9.62%, 'R': 1.92%, 'N': 9.62%, 'D': 5.77%, 'C': 7.69%, 'Q': 0%, 'E': 7.69%, 'G': 5.77%, 'H': 0%, 'I': 3.85%, 'L': 3.85%, 'K': 11.54%, 'M': 1.92%, 'F': 5.77%, 'P': 3.85%, 'S': 9.62%, 'T': 3.85%, 'W': 0%, 'Y': 1.92%, 'V': 5.77%

Missing Amino Acid(s)

H, Q, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, R, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5632.37 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	56.346	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	19.733	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.433	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.553	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.354	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.244	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.212, 0.288, 0.231 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.077	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1740	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Schnell N, Entian KD, Schneider U, et al. Prepeptide sequence of epidermin, a ribosomally synthesized antibiotic with four sulphide-rings. Nature. 1988;333(6170):276-8. Published 1988 May 19. doi:10.1038/333276a0

PMID: 2835685

Citation 2: Schnell N, Engelke G, Augustin J, et al. Analysis of genes involved in the biosynthesis of lantibiotic epidermin. Eur J Biochem. 1992;204(1):57-68. Published 1992 Feb 15. doi:10.1111/j.1432-1033.1992.tb16605.x

PMID: 1740156

Citation 3: Allgaier H, Jung G, Werner RG, et al. Epidermin: sequencing of a heterodetic tetracyclic 21-peptide amide antibiotic. Eur J Biochem. 1986;160(1):9-22. Published 1986 Oct 1. doi:10.1111/j.1432-1033.1986.tb09933.x

PMID: 3769923

Citation 4: Blaesse M, Kupke T, Huber R, et al. Crystal structure of the peptidyl-cysteine decarboxylase EpiD complexed with a pentapeptide substrate. EMBO J. 2000;19(23):6299-310. Published 2000 Dec 1. doi:10.1093/emboj/19.23.6299

PMID: 11101502

5.2 Protein Sequence Databases

UniProt: P08136

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P08136

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X07840	GenBank \|\| EMBL
2.	X07840	GenBank \|\| EMBL
3.	X62386	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_002498697.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006079

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download