AMPDB_647 | Cecropin-B

1 General Description

AMPDB ID: AMPDB_647

Protein Names: Cecropin-B (Lepidopteran-A B)

Protein Family: Cecropin family

Gene Name: CECB1; CECB2

Source Organism: Bombyx mori (Silk moth)

Protein Length: 63 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK

FASTA format

Counts of Amino Acids

'A': 9, 'R': 3, 'N': 2, 'D': 1, 'C': 0, 'Q': 0, 'E': 3, 'G': 5, 'H': 0, 'I': 7, 'L': 5, 'K': 8, 'M': 3, 'F': 4, 'P': 3, 'S': 4, 'T': 1, 'W': 1, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 14.29%, 'R': 4.76%, 'N': 3.17%, 'D': 1.59%, 'C': 0%, 'Q': 0%, 'E': 4.76%, 'G': 7.94%, 'H': 0%, 'I': 11.11%, 'L': 7.94%, 'K': 12.7%, 'M': 4.76%, 'F': 6.35%, 'P': 4.76%, 'S': 6.35%, 'T': 1.59%, 'W': 1.59%, 'Y': 0%, 'V': 6.35%

Missing Amino Acid(s)

C, H, Q, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6831.29 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	106.984	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	47.01	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.367	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.91	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.234	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.001	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.333, 0.222, 0.317 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.079	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Taniai K, Kadono-Okuda K, Kato Y, et al. Structure of two cecropin B-encoding genes and bacteria-inducible DNA-binding proteins which bind to the 5'-upstream regulatory region in the silkworm, Bombyx mori. Gene. 1995;163(2):215-9. Published 1995 Oct 3. doi:10.1016/0378-1119(95)00408-x

PMID: 7590269

Citation 2: Taniai K, Kato Y, Hirochika H, et al. Isolation and nucleotide sequence of cecropin B cDNA clones from the silkworm, Bombyx mori. Biochim Biophys Acta. 1992;1132(2):203-6. Published 1992 Sep 24. doi:10.1016/0167-4781(92)90013-p

PMID: 1390892

Citation 3: Kato Y, Taniai K, Hirochika H, et al. Expression and characterization of cDNAs for cecropin B, an antibacterial protein of the silkworm, Bombyx mori. Insect Biochem Mol Biol. 1993;23(2):285-90. Published 1993 Mar. doi:10.1016/0965-1748(93)90009-h

PMID: 8485525

Citation 4: Yamano Y, Matsumoto M, Inoue K, et al. Cloning of cDNAs for cecropins A and B, and expression of the genes in the silkworm, Bombyx mori. Biosci Biotechnol Biochem. 1994;58(8):1476-8. Published 1994 Aug. doi:10.1271/bbb.58.1476

PMID: 7765280

Citation 5: Morishima I, Suginaka S, Ueno T, et al. Isolation and structure of cecropins, inducible antibacterial peptides, from the silkworm, Bombyx mori. Comp Biochem Physiol B. 1990;95(3):551-4. Published 1990. doi:10.1016/0305-0491(90)90019-p

PMID: 2184991

Citation 6: Lee WJ, Brey PT, Brey PT. Isolation and identification of cecropin antibacterial peptides from the extracellular matrix of the insect integument. Anal Biochem. 1994;217(2):231-5. Published 1994 Mar. doi:10.1006/abio.1994.1113

PMID: 8203751

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P04142

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	D25320	GenBank \|\| EMBL
2.	D25321	GenBank \|\| EMBL
3.	D11114	GenBank \|\| EMBL
4.	D11113	GenBank \|\| EMBL
5.	S60579	GenBank \|\| EMBL
6.	S74297	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875

PANTHER: Not found

PROSITE: PS00268

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download