AMPDB_645 | Cecropin-A

1 General Description

AMPDB ID: AMPDB_645

Protein Names: Cecropin-A (Cecropin-C)

Protein Family: Cecropin family

Gene Name: Nil

Source Organism: Hyalophora cecropia (Cecropia moth) (Samia cecropia)

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MNFSRIFFFVFACLTALAMVNAAPEPKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKG

FASTA format

Counts of Amino Acids

'A': 10, 'R': 2, 'N': 3, 'D': 1, 'C': 1, 'Q': 3, 'E': 2, 'G': 5, 'H': 0, 'I': 6, 'L': 3, 'K': 7, 'M': 2, 'F': 6, 'P': 3, 'S': 1, 'T': 2, 'W': 1, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 15.63%, 'R': 3.13%, 'N': 4.69%, 'D': 1.56%, 'C': 1.56%, 'Q': 4.69%, 'E': 3.13%, 'G': 7.81%, 'H': 0%, 'I': 9.38%, 'L': 4.69%, 'K': 10.94%, 'M': 3.13%, 'F': 9.38%, 'P': 4.69%, 'S': 1.56%, 'T': 3.13%, 'W': 1.56%, 'Y': 0%, 'V': 9.38%

Missing Amino Acid(s)

H, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, D, S, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6952.35 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	97.656	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.716	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.422	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.795	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.914	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.938	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.344, 0.188, 0.266 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.109	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Gudmundsson GH, Lidholm DA, Asling B, et al. The cecropin locus. Cloning and expression of a gene cluster encoding three antibacterial peptides in Hyalophora cecropia. J Biol Chem. 1991;266(18):11510-7. Published 1991 Jun 25. doi:

PMID: 1711035

Citation 2: Hultmark D, EngstrÃ¶m A, Bennich H, et al. Insect immunity: isolation and structure of cecropin D and four minor antibacterial components from Cecropia pupae. Eur J Biochem. 1982;127(1):207-17. Published 1982 Sep. doi:10.1111/j.1432-1033.1982.tb06857.x

PMID: 7140755

Citation 3: Steiner H, Hultmark D, EngstrÃ¶m A, et al. Sequence and specificity of two antibacterial proteins involved in insect immunity. Nature. 1981;292(5820):246-8. Published 1981 Jul 16. doi:10.1038/292246a0

PMID: 7019715

Citation 4: Holak TA, EngstrÃ¶m A, Kraulis PJ, et al. The solution conformation of the antibacterial peptide cecropin A: a nuclear magnetic resonance and dynamical simulated annealing study. Biochemistry. 1988;27(20):7620-9. Published 1988 Oct 4. doi:10.1021/bi00420a008

PMID: 3207693

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P01507

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X06672	GenBank \|\| EMBL
2.	M63845	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875

PANTHER: Not found

PROSITE: PS00268

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download