AMPDB_634 | Beta-defensin 4

PEPTIDE SUMMARY

Beta-defensin 4

1 General Description

AMPDB ID: AMPDB_634

Protein Names: Beta-defensin 4 (BD-4) (BD-2) (Defensin; beta 4) (RBD-2) (RBD-4)

Protein Family: Beta-defensin family

Gene Name: Defb4 Defb2 Defb3

Source Organism: Rattus norvegicus (Rat)

Protein Length: 63 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MRIHYLLFSFLLVLLSPLSAFTQSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 4, 'N': 2, 'D': 0, 'C': 6, 'Q': 2, 'E': 0, 'G': 7, 'H': 1, 'I': 4, 'L': 9, 'K': 4, 'M': 1, 'F': 4, 'P': 4, 'S': 4, 'T': 5, 'W': 1, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 1.59%, 'R': 6.35%, 'N': 3.17%, 'D': 0%, 'C': 9.52%, 'Q': 3.17%, 'E': 0%, 'G': 11.11%, 'H': 1.59%, 'I': 6.35%, 'L': 14.29%, 'K': 6.35%, 'M': 1.59%, 'F': 6.35%, 'P': 6.35%, 'S': 6.35%, 'T': 7.94%, 'W': 1.59%, 'Y': 1.59%, 'V': 4.76%

Missing Amino Acid(s)

D, E

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, H, M, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6946.41 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	95.873	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	43.813	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.41	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.536	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.099	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.715	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.349, 0.27, 0.175 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7365	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Chemotaxis, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Jia HP, Mills JN, Barahmand-Pour F, et al. Molecular cloning and characterization of rat genes encoding homologues of human beta-defensins. Infect Immun. 1999;67(9):4827-33. Published 1999 Sep. doi:10.1128/IAI.67.9.4827-4833.1999

PMID: 10456937

Citation 2: Patil AA, Cai Y, Sang Y, et al. Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract. Physiol Genomics. 2005;23(1):5-17. Published 2005 Sep 21. doi:10.1152/physiolgenomics.00104.2005

PMID: 16033865

5.2 Protein Sequence Databases

UniProt: O88514

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: O88514

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF068861	GenBank \|\| EMBL
2.	AY621374	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_071989.1

5.5 Protein-Protein Interaction Databases

STRING: 10116.ENSRNOP00000054838

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000160995

KEGG: rno:64389

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000160995

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download