AMPDB_632 | Lantibiotic mutacin-1140

PEPTIDE SUMMARY

Lantibiotic mutacin-1140

1 General Description

AMPDB ID: AMPDB_632

Protein Names: Lantibiotic mutacin-1140 (Mutacin III)

Protein Family: Type A lantibiotic family

Gene Name: lanA mutA

Source Organism: Streptococcus mutans

Protein Length: 63 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MSNTQLLEVLGTETFDVQEDLFAFDTTDTTIVASNDDPDTRFKSWSLCTPGCARTGSFNSYCC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 2, 'N': 3, 'D': 7, 'C': 4, 'Q': 2, 'E': 3, 'G': 3, 'H': 0, 'I': 1, 'L': 5, 'K': 1, 'M': 1, 'F': 5, 'P': 2, 'S': 6, 'T': 10, 'W': 1, 'Y': 1, 'V': 3

Frequencies of Amino Acids

'A': 4.76%, 'R': 3.17%, 'N': 4.76%, 'D': 11.11%, 'C': 6.35%, 'Q': 3.17%, 'E': 4.76%, 'G': 4.76%, 'H': 0%, 'I': 1.59%, 'L': 7.94%, 'K': 1.59%, 'M': 1.59%, 'F': 7.94%, 'P': 3.17%, 'S': 9.52%, 'T': 15.87%, 'W': 1.59%, 'Y': 1.59%, 'V': 4.76%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, K, M, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6967.62 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	55.714	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	19.711	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.26	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.309	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	3.679	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-7.243	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.254, 0.222, 0.19 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.111	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7240	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Hillman JD, NovÃ¡k J, Sagura E, et al. Genetic and biochemical analysis of mutacin 1140, a lantibiotic from Streptococcus mutans. Infect Immun. 1998;66(6):2743-9. Published 1998 Jun. doi:10.1128/IAI.66.6.2743-2749.1998

PMID: 9596742

Citation 2: Qi F, Chen P, Caufield PW, et al. Purification of mutacin III from group III Streptococcus mutans UA787 and genetic analyses of mutacin III biosynthesis genes. Appl Environ Microbiol. 1999;65(9):3880-7. Published 1999 Sep. doi:10.1128/AEM.65.9.3880-3887.1999

PMID: 10473390

Citation 3: Smith L, NovÃ¡k J, Rocca J, et al. Covalent structure of mutacin 1140 and a novel method for the rapid identification of lantibiotics. Eur J Biochem. 2000;267(23):6810-6. Published 2000 Dec. doi:10.1046/j.1432-1033.2000.01777.x

PMID: 11082191

5.2 Protein Sequence Databases

UniProt: O68586

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: O68586

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF051560	GenBank \|\| EMBL
2.	AF154675	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_002268802.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006079

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download