AMPDB_625 | Neuropeptide-like protein 31

PEPTIDE SUMMARY

Neuropeptide-like protein 31

1 General Description

AMPDB ID: AMPDB_625

Protein Names: Neuropeptide-like protein 31 [Cleaved into: QWGYGGY-amide; GYGGYGGY-amide; GYGGY-amide; GMYGGY-amide; PYGGYGW-amide]

Protein Family: YARP (YGGW-amide related peptide) family

Gene Name: nlp-31 B0213.6

Source Organism: Caenorhabditis elegans

Protein Length: 75 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MISTSSILVLVVLLACFMAANAQWGYGGYGRGYGGYGGYGRGYGGYGGYGRGYGGYGRGMYGGYGRPYGGYGWGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 5, 'N': 1, 'D': 0, 'C': 1, 'Q': 1, 'E': 0, 'G': 28, 'H': 0, 'I': 2, 'L': 4, 'K': 1, 'M': 3, 'F': 1, 'P': 1, 'S': 3, 'T': 1, 'W': 2, 'Y': 14, 'V': 3

Frequencies of Amino Acids

'A': 5.33%, 'R': 6.67%, 'N': 1.33%, 'D': 0%, 'C': 1.33%, 'Q': 1.33%, 'E': 0%, 'G': 37.33%, 'H': 0%, 'I': 2.67%, 'L': 5.33%, 'K': 1.33%, 'M': 4%, 'F': 1.33%, 'P': 1.33%, 'S': 4%, 'T': 1.33%, 'W': 2.67%, 'Y': 18.67%, 'V': 4%

Missing Amino Acid(s)

D, E, H

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, F, K, N, P, Q, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7787.72 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	48.133	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	5.183	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.191	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.525	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.709	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.924	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.347, 0.44, 0.147 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.227	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	31860, 31860	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

M.luteus (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: C. elegans Sequencing Consortium. Genome sequence of the nematode C. elegans: a platform for investigating biology. Science. 1998;282(5396):2012-8. Published 1998 Dec 11. doi:10.1126/science.282.5396.2012

PMID: 9851916

Citation 2: Nathoo AN, Moeller RA, Westlund BA, et al. Identification of neuropeptide-like protein gene families in Caenorhabditiselegans and other species. Proc Natl Acad Sci U S A. 2001;98(24):14000-5. Published 2001 Nov 20. doi:10.1073/pnas.241231298

PMID: 11717458

Citation 3: Couillault C, Pujol N, Reboul J, et al. TLR-independent control of innate immunity in Caenorhabditis elegans by the TIR domain adaptor protein TIR-1, an ortholog of human SARM. Nat Immunol. 2004;5(5):488-94. Published 2004 May. doi:10.1038/ni1060

PMID: 15048112

5.2 Protein Sequence Databases

UniProt: O44662

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: O44662

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FO080121	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_504107.1

5.5 Protein-Protein Interaction Databases

STRING: 6239.B0213.6

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: 43858

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: cel:CELE_B0213.6

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download