AMPDB_622 | Lysozyme-like protein 7

1 General Description

AMPDB ID: AMPDB_622

Protein Names: Lysozyme-like protein 7

Protein Family: Glycosyl hydrolase 25 family

Gene Name: lys-7 C02A12.4

Source Organism: Caenorhabditis elegans

Protein Length: 283 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

MAHKSIVIFSVLAVLCHSASVKVPPIVDSSLPVKFSEVIAEPAPNVPSNLASYAYALDIYVQTTLSQLQCIKQAGYCAVFVRAYNPAGQGSFDTSSCVTIQNAYKAGLGIEIYMTPQPVSNKQGYQQLDEIIQGLTARAITVRAIWIQVTSPTNWPNNANSNINFINSIVSRARQSGLTVGIYTSYYDWNQITTGWSNIGNDVLLWYWNVYSGGVTGETPANFNDFRKFGCWTAPSVKQFAQDETVCGITVNRDVYLAGNVLKAVEEDGKIYAGGFVQGSLKI

FASTA format

Counts of Amino Acids

'A': 25, 'R': 7, 'N': 20, 'D': 10, 'C': 6, 'Q': 17, 'E': 8, 'G': 21, 'H': 2, 'I': 23, 'L': 16, 'K': 11, 'M': 2, 'F': 10, 'P': 13, 'S': 24, 'T': 18, 'W': 7, 'Y': 15, 'V': 28

Frequencies of Amino Acids

'A': 8.83%, 'R': 2.47%, 'N': 7.07%, 'D': 3.53%, 'C': 2.12%, 'Q': 6.01%, 'E': 2.83%, 'G': 7.42%, 'H': 0.71%, 'I': 8.13%, 'L': 5.65%, 'K': 3.89%, 'M': 0.71%, 'F': 3.53%, 'P': 4.59%, 'S': 8.48%, 'T': 6.36%, 'W': 2.47%, 'Y': 5.3%, 'V': 9.89%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M

Hydrophobic Amino Acid(s) Count

145

Hydrophilic Amino Acid(s) Count

138

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	30880 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	91.272	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	41.311	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.048	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.602	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.199	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.189	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.35, 0.276, 0.18 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.113	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	60850, 61225	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

B.thuringiensis (Gram-positive), C.neoformans, M.nematophilum (Not characterize), S.boydii (Gram-negative), S.flexneri (Gram-negative), S.typhimurium

4.2 Antimicrobial Activity

Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: C. elegans Sequencing Consortium. Genome sequence of the nematode C. elegans: a platform for investigating biology. Science. 1998;282(5396):2012-8. Published 1998 Dec 11. doi:10.1126/science.282.5396.2012

PMID: 9851916

Citation 2: Mallo GV, Kurz CL, Couillault C, et al. Inducible antibacterial defense system in C. elegans. Curr Biol. 2002;12(14):1209-14. Published 2002 Jul 23. doi:10.1016/s0960-9822(02)00928-4

PMID: 12176330

Citation 3: O'Rourke D, Baban D, Demidova M, et al. Genomic clusters, putative pathogen recognition molecules, and antimicrobial genes are induced by infection of C. elegans with M. nematophilum. Genome Res. 2006;16(8):1005-16. Published 2006 Aug. doi:10.1101/gr.50823006

PMID: 16809667

Citation 4: Alper S, McBride SJ, Lackford B, et al. Specificity and complexity of the Caenorhabditis elegans innate immune response. Mol Cell Biol. 2007;27(15):5544-53. Published 2007 Aug. doi:10.1128/MCB.02070-06

PMID: 17526726

Citation 5: Marsh EK, van den Berg MC, May RC, et al. A two-gene balance regulates Salmonella typhimurium tolerance in the nematode Caenorhabditis elegans. PLoS One. 2011;6(3):e16839. Published 2011 Mar 2. doi:10.1371/journal.pone.0016839

PMID: 21399680

Citation 6: Boehnisch C, Wong D, Habig M, et al. Protist-type lysozymes of the nematode Caenorhabditis elegans contribute to resistance against pathogenic Bacillus thuringiensis. PLoS One. 2011;6(9):e24619. Published 2011. doi:10.1371/journal.pone.0024619

PMID: 21931778

Citation 7: Kesika P, Balamurugan K, Balamurugan K. Studies on Shigella boydii infection in Caenorhabditis elegans and bioinformatics analysis of immune regulatory protein interactions. Biochim Biophys Acta. 2012;1824(12):1449-56. Published 2012 Dec. doi:10.1016/j.bbapap.2012.07.008

PMID: 22841995

Citation 8: Kong C, Tan MW, Nathan S, et al. Orthosiphon stamineus protects Caenorhabditis elegans against Staphylococcus aureus infection through immunomodulation. Biol Open. 2014;3(7):644-55. Published 2014 Jun 27. doi:10.1242/bio.20148334

PMID: 24972867

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: O16202

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	BX284605	GenBank \|\| EMBL

RefSeq: NP_503972.1

5.5 Protein-Protein Interaction Databases

STRING: 6239.C02A12.4

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002053, IPR017853

PANTHER: Not found

PROSITE: PS51904

5.8 Genome Annotation Databases

Ensembl: ENSGT00970000195882

5.9 Phylogenomic Databases

GeneTree: ENSGT00970000195882

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download