AMPDB_618 | Germin-like protein
PEPTIDE SUMMARY
Germin-like protein
1 General Description
AMPDB ID: AMPDB_618
Protein Names: Germin-like protein (Ma-Glp)
Protein Family: Germin family
Gene Name: Nil
Protein Length: 209 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MIVPIFFLFSLLFSSSHGAIQDFCVADYSAPQGPAGYSCKNPAKVTVDNFVYSGLGITGNTTNLIKAAVTTAFDNQFPGVNGLGISLARPDLAPGGVIPFHTHPGASEIIIVIEGSLCAAFVSSDNKVYLKSLKKGDTMIFPSGLLHFQLNAGKNNALFFVAFNSPNPGLQLVDYALFGNDLATELVAAASFLDPAEIKRLKAVLGGSG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 23, 'R': 2, 'N': 13, 'D': 10, 'C': 3, 'Q': 5, 'E': 4, 'G': 21, 'H': 4, 'I': 13, 'L': 23, 'K': 10, 'M': 2, 'F': 17, 'P': 13, 'S': 17, 'T': 9, 'W': 0, 'Y': 5, 'V': 15
Frequencies of Amino Acids
'A': 11%, 'R': 0.96%, 'N': 6.22%, 'D': 4.78%, 'C': 1.44%, 'Q': 2.39%, 'E': 1.91%, 'G': 10.05%, 'H': 1.91%, 'I': 6.22%, 'L': 11%, 'K': 4.78%, 'M': 0.96%, 'F': 8.13%, 'P': 6.22%, 'S': 8.13%, 'T': 4.31%, 'W': 0%, 'Y': 2.39%, 'V': 7.18%
Missing Amino Acid(s)
W
Most Occurring Amino Acid(s)
A, L
Less Occurring Amino Acid(s)
M, R
Hydrophobic Amino Acid(s) Count
127
Hydrophilic Amino Acid(s) Count
82
Basic Amino Acid(s) Count
14
Acidic Amino Acid(s) Count
16
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 21888.2 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 98.995 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 23.217 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.387 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.527 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 6.501 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -1.82 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.349, 0.306, 0.249 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.105 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 7450, 7575 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
A.hydrophila (Gram-negative), B.cereus (Gram-positive), B.subtilis (Gram-positive), P.entomophila (Gram-negative), P.rhodesiae (Gram-negative), S.enterica (Gram-negative)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Patnaik BB, Kim DH, Oh SH, et al. Molecular cloning and characterization of novel Morus alba germin-like protein gene which encodes for a silkworm gut digestion-resistant antimicrobial protein. PLoS One. 2012;7(12):e50900. Published 2012. doi:10.1371/journal.pone.0050900
PMID: 23284650
5.2 Protein Sequence Databases
UniProt: L8BRS3
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: L8BRS3
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. HE805964 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: PS00725
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India