AMPDB_614 | L-amino acid oxidase Cdc18

PEPTIDE SUMMARY

L-amino acid oxidase Cdc18

1 General Description

AMPDB ID: AMPDB_614

Protein Names: L-amino acid oxidase Cdc18 (CdcLAAO) (LAO) (EC 1.4.3.2)

Protein Family: Flavin monoamine oxidase family; FIG1 subfamily

Gene Name: Nil

Source Organism: Crotalus durissus cumanensis (South American rattlesnake)

Protein Length: 498 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

SCADDRNPLEECFRETDYEEFLEIARNGLTVTSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERVGGRVRTYRKKDWYANLGPMRLPTKHRIVREYIRKFGLQLNEFFQENENAWYFIKNIRKRVREVKNNPGILEYPVKPSEEGKSAAQLYVESLRKVVKELKRTNCKYILDKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFGYEKRFDEIVGGMDQLPTSMYEAIKEKVQVHFNARVIEIQQNDRETKVTYQTSANEMPSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCKRKFWEDDGIRGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPKEDIQTFCRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPFKRIYFAGEYTAQFHGWIDSTIKSGLTAARDVNRASENPSGIHLSNDN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 34, 'R': 32, 'N': 24, 'D': 29, 'C': 7, 'Q': 16, 'E': 35, 'G': 33, 'H': 12, 'I': 33, 'L': 34, 'K': 34, 'M': 8, 'F': 25, 'P': 21, 'S': 30, 'T': 29, 'W': 5, 'Y': 26, 'V': 31

Frequencies of Amino Acids

'A': 6.83%, 'R': 6.43%, 'N': 4.82%, 'D': 5.82%, 'C': 1.41%, 'Q': 3.21%, 'E': 7.03%, 'G': 6.63%, 'H': 2.41%, 'I': 6.63%, 'L': 6.83%, 'K': 6.83%, 'M': 1.61%, 'F': 5.02%, 'P': 4.22%, 'S': 6.02%, 'T': 5.82%, 'W': 1%, 'Y': 5.22%, 'V': 6.22%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

224

Hydrophilic Amino Acid(s) Count

274

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	56827.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.349	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	34.782	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.475	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.942	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.048	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.698	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.309, 0.217, 0.223 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.112	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	66240, 66615	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.baumannii (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Oxidoreductase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Vargas LJ, Quintana JC, PereaÃ±ez JA, et al. Cloning and characterization of an antibacterial L-amino acid oxidase from Crotalus durissus cumanensis venom. Toxicon. 2013;64:1-11. Published 2013 Mar 15. doi:10.1016/j.toxicon.2012.11.027

PMID: 23287728

Citation 2: Calvete JJ, Sanz L, Cid P, et al. Snake venomics of the Central American rattlesnake Crotalus simus and the South American Crotalus durissus complex points to neurotoxicity as an adaptive paedomorphic trend along Crotalus dispersal in South America. J Proteome Res. 2010;9(1):528-44. Published 2010 Jan. doi:10.1021/pr9008749

PMID: 19863078

5.2 Protein Sequence Databases

UniProt: K9N7B7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: K9N7B7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KC154267	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002937, IPR036188

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download