AMPDB_613 | Fungal defensin eurocin

PEPTIDE SUMMARY

Fungal defensin eurocin

1 General Description

AMPDB ID: AMPDB_613

Protein Names: Fungal defensin eurocin

Protein Family: Invertebrate defensin family

Gene Name: Nil

Source Organism: Aspergillus amstelodami

Protein Length: 42 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GFGCPGDAYQCSEHCRALGGGRTGGYCAGPWYLGHPTCTCSF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 2, 'N': 0, 'D': 1, 'C': 6, 'Q': 1, 'E': 1, 'G': 10, 'H': 2, 'I': 0, 'L': 2, 'K': 0, 'M': 0, 'F': 2, 'P': 3, 'S': 2, 'T': 3, 'W': 1, 'Y': 3, 'V': 0

Frequencies of Amino Acids

'A': 7.14%, 'R': 4.76%, 'N': 0%, 'D': 2.38%, 'C': 14.29%, 'Q': 2.38%, 'E': 2.38%, 'G': 23.81%, 'H': 4.76%, 'I': 0%, 'L': 4.76%, 'K': 0%, 'M': 0%, 'F': 4.76%, 'P': 7.14%, 'S': 4.76%, 'T': 7.14%, 'W': 2.38%, 'Y': 7.14%, 'V': 0%

Missing Amino Acid(s)

I, K, M, N, V

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, E, Q, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4344.83 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	25.714	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	26.505	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.229	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.355	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.204	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.192	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.19, 0.357, 0.143 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.143	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	9970, 10345	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.pneumoniae (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolytic, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Oeemig JS, Lynggaard C, Knudsen DH, et al. Eurocin, a new fungal defensin: structure, lipid binding, and its mode of action. J Biol Chem. 2012;287(50):42361-72. Published 2012 Dec 7. doi:10.1074/jbc.M112.382028

PMID: 23093408

5.2 Protein Sequence Databases

UniProt: K7N5L0

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: K7N5L0

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download