AMPDB_610 | Lariatin

PEPTIDE SUMMARY

Lariatin

1 General Description

AMPDB ID: AMPDB_610

Protein Names: Lariatin (Class II lasso peptide) (Lariat peptide) (Ribosomally synthesized and post-translationally modified peptide) (RiPP) [Cleaved into: Lariatin-A; Lariatin-B]

Protein Family: Nil

Gene Name: larA

Source Organism: Rhodococcus jostii

Protein Length: 46 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MTSQPSKKTYNAPSLVQRGKFARTTAGSQLVYREWVGHSNVIKPGP

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 3, 'N': 2, 'D': 0, 'C': 0, 'Q': 3, 'E': 1, 'G': 4, 'H': 1, 'I': 1, 'L': 2, 'K': 4, 'M': 1, 'F': 1, 'P': 4, 'S': 5, 'T': 4, 'W': 1, 'Y': 2, 'V': 4

Frequencies of Amino Acids

'A': 6.52%, 'R': 6.52%, 'N': 4.35%, 'D': 0%, 'C': 0%, 'Q': 6.52%, 'E': 2.17%, 'G': 8.7%, 'H': 2.17%, 'I': 2.17%, 'L': 4.35%, 'K': 8.7%, 'M': 2.17%, 'F': 2.17%, 'P': 8.7%, 'S': 10.87%, 'T': 8.7%, 'W': 2.17%, 'Y': 4.35%, 'V': 8.7%

Missing Amino Acid(s)

C, D

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, F, H, I, M, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5074.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	57.174	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	14.828	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.709	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.446	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.259	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.088	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.239, 0.326, 0.152 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.087	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8480	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

M.smegmatis (Gram-positive), M.tuberculosis (Gram-positive), Mycobacterium species (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-tuberculosis, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Inokoshi J, Matsuhama M, Miyake M, et al. Molecular cloning of the gene cluster for lariatin biosynthesis of Rhodococcus jostii K01-B0171. Appl Microbiol Biotechnol. 2012;95(2):451-60. Published 2012 Jul. doi:10.1007/s00253-012-3973-8

PMID: 22388571

Citation 2: Iwatsuki M, Uchida R, Takakusagi Y, et al. Lariatins, novel anti-mycobacterial peptides with a lasso structure, produced by Rhodococcus jostii K01-B0171. J Antibiot (Tokyo). 2007;60(6):357-63. Published 2007 Jun. doi:10.1038/ja.2007.48

PMID: 17617692

Citation 3: Iwatsuki M, Koizumi Y, Gouda H, et al. Lys17 in the 'lasso' peptide lariatin A is responsible for anti-mycobacterial activity. Bioorg Med Chem Lett. 2009;19(10):2888-90. Published 2009 May 15. doi:10.1016/j.bmcl.2009.03.033

PMID: 19362475

Citation 4: Iwatsuki M, Tomoda H, Uchida R, et al. Lariatins, antimycobacterial peptides produced by Rhodococcus sp. K01-B0171, have a lasso structure. J Am Chem Soc. 2006;128(23):7486-91. Published 2006 Jun 14. doi:10.1021/ja056780z

PMID: 16756302

5.2 Protein Sequence Databases

UniProt: H7C8I3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: H7C8I3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB593691	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download