AMPDB_592 | Cliotide T1

PEPTIDE SUMMARY

Cliotide T1

1 General Description

AMPDB ID: AMPDB_592

Protein Names: Cliotide T1

Protein Family: Cyclotide family; Bracelet subfamily

Gene Name: Nil

Source Organism: Clitoria ternatea (Butterfly pea)

Protein Length: 95 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GIPCGESCVFIPCITGAIGCSCKSKVCYRNHVIAAEAKTMDDHHLLCQSHEDCITKGTGNFCAPFPDQDIKYGWCFRAESEGFMLKDHLKMSITN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 2, 'N': 3, 'D': 6, 'C': 10, 'Q': 2, 'E': 5, 'G': 8, 'H': 5, 'I': 8, 'L': 4, 'K': 7, 'M': 3, 'F': 5, 'P': 4, 'S': 6, 'T': 5, 'W': 1, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 6.32%, 'R': 2.11%, 'N': 3.16%, 'D': 6.32%, 'C': 10.53%, 'Q': 2.11%, 'E': 5.26%, 'G': 8.42%, 'H': 5.26%, 'I': 8.42%, 'L': 4.21%, 'K': 7.37%, 'M': 3.16%, 'F': 5.26%, 'P': 4.21%, 'S': 6.32%, 'T': 5.26%, 'W': 1.05%, 'Y': 2.11%, 'V': 3.16%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10476.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	64.737	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	27.22	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.109	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.454	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.633	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.159	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.242, 0.221, 0.189 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.084	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 9105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), K.pneumoniae (Gram-negative), P.aeruginosa (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Plant defense, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Nguyen GK, Zhang S, Nguyen NT, et al. Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J Biol Chem. 2011;286(27):24275-87. Published 2011 Jul 8. doi:10.1074/jbc.M111.229922

PMID: 21596752

5.2 Protein Sequence Databases

UniProt: G1CWH0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: G1CWH0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JF931988	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR032000, IPR005535, IPR012323, IPR036146

PANTHER: Not found

PROSITE: PS51052, PS60008

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download