AMPDB_58834 | HNH endonuclease domain protein

PEPTIDE SUMMARY

HNH endonuclease domain protein

1 General Description

AMPDB ID: AMPDB_58834

Protein Names: HNH endonuclease domain protein

Protein Family: Colicin pyosin nuclease family

Gene Name: HMPREF1604_02685

Source Organism: Escherichia coli 908519

Protein Length: 396 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MKGCTDAGTAEEPAENFGQVAIFAQPVVDDCCGYHHPEANVIGEPAEAQTMLLFPSSVLATQIWGKWSLSGVLSATRGSYIGALASALYIPSAGEGSARVPGRDEFWYEEELRQKALAGSTATTRVRFFWGTDIHGKPQVYGVHTGEGTPYENVRVANMQWNEQTQRYEFTPAHDVDGPLITWTPENPEHGNVPGHTGNDRPPLDQPTILVTPIPDGTDTYTTPPFPVPDPKEFNDYILVFPAGSGIKPIYVYLKEDPRKLPGVVTGRGVPLSPGTRWLDMSVSNNGNGAPIPAHIADKLRGREFKTFDEFREALWLEVSKDSVLLAQFIKSNQNNVSQGYSPYVPEEGYYYGPNEIVKKFQIHHVVAIEHGGGVYDIDNFRIVTPRLHDEIHYRR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 27, 'R': 19, 'N': 17, 'D': 21, 'C': 3, 'Q': 14, 'E': 28, 'G': 38, 'H': 13, 'I': 21, 'L': 23, 'K': 14, 'M': 4, 'F': 16, 'P': 36, 'S': 19, 'T': 26, 'W': 8, 'Y': 18, 'V': 31

Frequencies of Amino Acids

'A': 6.82%, 'R': 4.8%, 'N': 4.29%, 'D': 5.3%, 'C': 0.76%, 'Q': 3.54%, 'E': 7.07%, 'G': 9.6%, 'H': 3.28%, 'I': 5.3%, 'L': 5.81%, 'K': 3.54%, 'M': 1.01%, 'F': 4.04%, 'P': 9.09%, 'S': 4.8%, 'T': 6.57%, 'W': 2.02%, 'Y': 4.55%, 'V': 7.83%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

204

Hydrophilic Amino Acid(s) Count

192

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	43863.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	72.854	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	30.223	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.449	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.518	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.136	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-14.967	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.295, 0.278, 0.207 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.106	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	70820, 70945	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Endonuclease, Hydrolase, Nuclease

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: V0V8E4

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: V0V8E4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AXTL01000083	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR037146, IPR044925, IPR003615, IPR003060, IPR016128, IPR036302

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download