AMPDB_588 | Phylloseptin-S2

PEPTIDE SUMMARY

Phylloseptin-S2

1 General Description

AMPDB ID: AMPDB_588

Protein Names: Phylloseptin-S2 (PLS-S2)

Protein Family: Frog skin active peptide (FSAP) family; Phylloseptin subfamily

Gene Name: Nil

Source Organism: Phyllomedusa sauvagei (Sauvage`s leaf frog)

Protein Length: 66 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGLVSLSICEEEKRETEEEEHDQEEDDKSEEKRFLSLIPHIVSGVASLAKHFG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 2, 'N': 0, 'D': 3, 'C': 1, 'Q': 1, 'E': 12, 'G': 3, 'H': 3, 'I': 3, 'L': 10, 'K': 6, 'M': 1, 'F': 5, 'P': 1, 'S': 7, 'T': 1, 'W': 0, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 4.55%, 'R': 3.03%, 'N': 0%, 'D': 4.55%, 'C': 1.52%, 'Q': 1.52%, 'E': 18.18%, 'G': 4.55%, 'H': 4.55%, 'I': 4.55%, 'L': 15.15%, 'K': 9.09%, 'M': 1.52%, 'F': 7.58%, 'P': 1.52%, 'S': 10.61%, 'T': 1.52%, 'W': 0%, 'Y': 0%, 'V': 6.06%

Missing Amino Acid(s)

N, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, P, Q, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7563.62 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	98.939	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	67.494	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.227	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.674	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.515	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-6.77	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.333, 0.167, 0.394 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.076	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Leishmania species

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-parasitic

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Raja Z, AndrÃ© S, Piesse C, et al. Structure, antimicrobial activities and mode of interaction with membranes of novel [corrected] phylloseptins from the painted-belly leaf frog, Phyllomedusa sauvagii. PLoS One. 2013;8(8):e70782. Published 2013. doi:10.1371/journal.pone.0070782

PMID: 23967105

5.2 Protein Sequence Databases

UniProt: F7UI85

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: F7UI85

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AM903078	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download