AMPDB_587 | Phylloseptin-S1
PEPTIDE SUMMARY
Phylloseptin-S1
1 General Description
AMPDB ID: AMPDB_587
Protein Names: Phylloseptin-S1 (PLS-S1) (Phylloseptin-1) (PSN-1)
Protein Family: Frog skin active peptide (FSAP) family; Phylloseptin subfamily
Gene Name: Nil
Protein Length: 66 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MAFLKKSLFLVLFLGLVSLSICEEEKRETEEEEHDQEEDDKSEEKRFLSLIPHIVSGVASIAKHFG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 2, 'N': 0, 'D': 3, 'C': 1, 'Q': 1, 'E': 12, 'G': 3, 'H': 3, 'I': 4, 'L': 9, 'K': 6, 'M': 1, 'F': 5, 'P': 1, 'S': 7, 'T': 1, 'W': 0, 'Y': 0, 'V': 4
Frequencies of Amino Acids
'A': 4.55%, 'R': 3.03%, 'N': 0%, 'D': 4.55%, 'C': 1.52%, 'Q': 1.52%, 'E': 18.18%, 'G': 4.55%, 'H': 4.55%, 'I': 6.06%, 'L': 13.64%, 'K': 9.09%, 'M': 1.52%, 'F': 7.58%, 'P': 1.52%, 'S': 10.61%, 'T': 1.52%, 'W': 0%, 'Y': 0%, 'V': 6.06%
Missing Amino Acid(s)
N, W, Y
Most Occurring Amino Acid(s)
E
Less Occurring Amino Acid(s)
C, M, P, Q, T
Hydrophobic Amino Acid(s) Count
30
Hydrophilic Amino Acid(s) Count
36
Basic Amino Acid(s) Count
15
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7563.62 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 98.939 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 67.494 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.217 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.674 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.515 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -6.77 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.333, 0.167, 0.379 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.076 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 0 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Leishmania species, S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-biofilm, Anti-parasitic, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Zhang R, Zhou M, Wang L, et al. Phylloseptin-1 (PSN-1) from Phyllomedusa sauvagei skin secretion: a novel broad-spectrum antimicrobial peptide with antibiofilm activity. Mol Immunol. 2010;47(11-12):2030-7. Published 2010 Jul. doi:10.1016/j.molimm.2010.04.010
PMID: 20451254
Citation 2: Raja Z, André S, Piesse C, et al. Structure, antimicrobial activities and mode of interaction with membranes of novel [corrected] phylloseptins from the painted-belly leaf frog, Phyllomedusa sauvagii. PLoS One. 2013;8(8):e70782. Published 2013. doi:10.1371/journal.pone.0070782
PMID: 23967105
5.2 Protein Sequence Databases
UniProt: F7UI84
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: F7UI84
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. FN667968 GenBank || EMBL
2. AM903077 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR004275, IPR016322
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India