AMPDB_584 | Panusin

PEPTIDE SUMMARY

Panusin

1 General Description

AMPDB ID: AMPDB_584

Protein Names: Panusin (Defensin-like peptide 7) (PaD7)

Protein Family: Beta-defensin family

Gene Name: Nil

Source Organism: Panulirus argus (Caribbean spiny lobster) (Palinurus argus)

Protein Length: 66 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTKAVLMLMLLVLVAATLVQGEPEPSYVGDCGSNGGSCVSSYCPYGNRLNYFCPLGRTCCRRSYG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 4, 'N': 3, 'D': 1, 'C': 6, 'Q': 1, 'E': 2, 'G': 8, 'H': 0, 'I': 0, 'L': 8, 'K': 2, 'M': 3, 'F': 1, 'P': 4, 'S': 6, 'T': 3, 'W': 0, 'Y': 5, 'V': 6

Frequencies of Amino Acids

'A': 4.55%, 'R': 6.06%, 'N': 4.55%, 'D': 1.52%, 'C': 9.09%, 'Q': 1.52%, 'E': 3.03%, 'G': 12.12%, 'H': 0%, 'I': 0%, 'L': 12.12%, 'K': 3.03%, 'M': 4.55%, 'F': 1.52%, 'P': 6.06%, 'S': 9.09%, 'T': 4.55%, 'W': 0%, 'Y': 7.58%, 'V': 9.09%

Missing Amino Acid(s)

H, I, W

Most Occurring Amino Acid(s)

G, L

Less Occurring Amino Acid(s)

D, F, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7102.32 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	78.182	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.429	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.17	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.636	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.364	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.625	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.303, 0.318, 0.242 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.091	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	7450, 7825	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), K.pneumoniae (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Montero-Alejo V, Acosta-Alba J, Perdomo-Morales R, et al. Defensin like peptide from Panulirus argus relates structurally with beta defensin from vertebrates. Fish Shellfish Immunol. 2012;33(4):872-9. Published 2012 Oct. doi:10.1016/j.fsi.2012.07.013

PMID: 22885029

Citation 2: Montero-Alejo V, Corzo G, Porro-SuardÃaz J, et al. Panusin represents a new family of Î²-defensin-like peptides in invertebrates. Dev Comp Immunol. 2017;67:310-321. Published 2017 Feb. doi:10.1016/j.dci.2016.09.002

PMID: 27616720

5.2 Protein Sequence Databases

UniProt: F6KSI8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: F6KSI8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	HQ599307	GenBank \|\| EMBL
2.	KT253226	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download