AMPDB_58106 | Defense protein 2

PEPTIDE SUMMARY

Defense protein 2

1 General Description

AMPDB ID: AMPDB_58106

Protein Names: Defense protein 2 (DFP-2)

Protein Family: Attacin sarcotoxin-2 family

Gene Name: Nil

Source Organism: Lonomia obliqua (Moth)

Protein Length: 113 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

TGSGKYNILHNDNHNLDLTGKFLECSRSNPNLSDYNKYSAILDYLYKDKLSASLGVAHSGLLDRTDLSALGKVNLLNDKNTRLDLFGGLTKSMSPKFDSGLKPNFGLQLESSF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 3, 'N': 11, 'D': 10, 'C': 1, 'Q': 1, 'E': 2, 'G': 10, 'H': 3, 'I': 2, 'L': 21, 'K': 10, 'M': 1, 'F': 5, 'P': 3, 'S': 14, 'T': 5, 'W': 0, 'Y': 5, 'V': 2

Frequencies of Amino Acids

'A': 3.54%, 'R': 2.65%, 'N': 9.73%, 'D': 8.85%, 'C': 0.88%, 'Q': 0.88%, 'E': 1.77%, 'G': 8.85%, 'H': 2.65%, 'I': 1.77%, 'L': 18.58%, 'K': 8.85%, 'M': 0.88%, 'F': 4.42%, 'P': 2.65%, 'S': 12.39%, 'T': 4.42%, 'W': 0%, 'Y': 4.42%, 'V': 1.77%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	12430 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	88.053	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	39.001	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.472	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.454	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.446	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.21	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.31, 0.336, 0.248 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.088	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	7450, 7450	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Veiga AB, Ribeiro JM, GuimarÃ£es JA, et al. A catalog for the transcripts from the venomous structures of the caterpillar Lonomia obliqua: identification of the proteins potentially involved in the coagulation disorder and hemorrhagic syndrome. Gene. 2005;355:11-27. Published 2005 Aug 1. doi:10.1016/j.gene.2005.05.002

PMID: 16023793

5.2 Protein Sequence Databases

UniProt: Q5MGP9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q5MGP9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY829737	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR005521

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download