AMPDB_580 | Esculentin-2ISa
PEPTIDE SUMMARY
Esculentin-2ISa
1 General Description
AMPDB ID: AMPDB_580
Protein Names: Esculentin-2ISa
Protein Family: Frog skin active peptide (FSAP) family; Esculentin subfamily
Gene Name: Nil
Protein Length: 78 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MFTLKKSLLLLFFLGTISLSVCKQERDADYEDKGEVEEVKRGIFSLIKGAAKLITKTVAKEAGKTGLELMACKVTNQC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 6, 'R': 2, 'N': 1, 'D': 3, 'C': 3, 'Q': 2, 'E': 7, 'G': 6, 'H': 0, 'I': 4, 'L': 11, 'K': 11, 'M': 2, 'F': 4, 'P': 0, 'S': 4, 'T': 6, 'W': 0, 'Y': 1, 'V': 5
Frequencies of Amino Acids
'A': 7.69%, 'R': 2.56%, 'N': 1.28%, 'D': 3.85%, 'C': 3.85%, 'Q': 2.56%, 'E': 8.97%, 'G': 7.69%, 'H': 0%, 'I': 5.13%, 'L': 14.1%, 'K': 14.1%, 'M': 2.56%, 'F': 5.13%, 'P': 0%, 'S': 5.13%, 'T': 7.69%, 'W': 0%, 'Y': 1.28%, 'V': 6.41%
Missing Amino Acid(s)
H, P, W
Most Occurring Amino Acid(s)
K, L
Less Occurring Amino Acid(s)
N, Y
Hydrophobic Amino Acid(s) Count
38
Hydrophilic Amino Acid(s) Count
40
Basic Amino Acid(s) Count
10
Acidic Amino Acid(s) Count
13
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 8600.21 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 101.282 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 10.931 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.072 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.681 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.896 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 2.822 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.321, 0.141, 0.333 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.064 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1615 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
B.subtilis (Gram-positive), C.albicans, E.coli (Gram-negative), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-MRSA, Anti-candida, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Iwakoshi-Ukena E, Ukena K, Okimoto A, et al. Identification and characterization of antimicrobial peptides from the skin of the endangered frog Odorrana ishikawae. Peptides. 2011;32(4):670-6. Published 2011 Apr. doi:10.1016/j.peptides.2010.12.013
PMID: 21193000
5.2 Protein Sequence Databases
UniProt: F1T151
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: F1T151
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. AB602053 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR012521, IPR004275
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India