AMPDB_57993 | Carocin S1K

PEPTIDE SUMMARY

Carocin S1K

1 General Description

AMPDB ID: AMPDB_57993

Protein Names: Carocin S1K

Protein Family: Nil

Gene Name: Nil

Source Organism: Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora)

Protein Length: 361 AA

Protein Existence: Predicted

2 Protein Sequence & Composition

2.1 Sequence

MRQCCRQPQQVVMAGTAAQAGAIAAAGGAVAQANQDAAKALTHQMKRLSGPSIWQGQLQMAQSFLLMGALIQHHLKGEKADLLTPEKLLEAANKQGTVPSRVRYQWMEDEETGRLKAVGYHTSMESGRDQVRVRLLKYDFPNNRYAFWEEGATGPTILWTPDNPGMELPTDTAHGEQPVIPSAVPGFEIPEMDDVSILATPMPEEKDFRDYILVFPENSFPPIYIYLSKLPVNLLDVDLYSNFIGRSRQGKYQADHMPSAAAVKAYLKRLYPDLRKDKLEKMAKEVAAIIIPTEIHQKISETYGGRNSADNIELDSQDLRGHWIVILHAIKPQLKEHGVTEEQLELARDKMHKLNEEQGLY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 36, 'R': 18, 'N': 11, 'D': 20, 'C': 2, 'Q': 24, 'E': 27, 'G': 24, 'H': 11, 'I': 20, 'L': 35, 'K': 22, 'M': 13, 'F': 8, 'P': 23, 'S': 16, 'T': 15, 'W': 5, 'Y': 13, 'V': 18

Frequencies of Amino Acids

'A': 9.97%, 'R': 4.99%, 'N': 3.05%, 'D': 5.54%, 'C': 0.55%, 'Q': 6.65%, 'E': 7.48%, 'G': 6.65%, 'H': 3.05%, 'I': 5.54%, 'L': 9.7%, 'K': 6.09%, 'M': 3.6%, 'F': 2.22%, 'P': 6.37%, 'S': 4.43%, 'T': 4.16%, 'W': 1.39%, 'Y': 3.6%, 'V': 4.99%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

182

Hydrophilic Amino Acid(s) Count

179

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	40497.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	83.85	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	46.931	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.456	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.7	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.296	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-6.087	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.274, 0.205, 0.307 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.072	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	46870, 46995	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Chuang DY, Chien YC, Wu HP, et al. Cloning and expression of the Erwinia carotovora subsp. carotovora gene encoding the low-molecular-weight bacteriocin carocin S1. J Bacteriol. 2007;189(2):620-6. Published 2007 Jan. doi:10.1128/JB.01090-06

PMID: 17071754

5.2 Protein Sequence Databases

UniProt: Q2V060

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q2V060

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF205141	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR016128, IPR036302

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download