AMPDB_57867 | Bacteriocin lactocin-705

PEPTIDE SUMMARY

Bacteriocin lactocin-705

1 General Description

AMPDB ID: AMPDB_57867

Protein Names: Bacteriocin lactocin-705

Protein Family: Nil

Gene Name: Nil

Source Organism: Lacticaseibacillus paracasei (Lactobacillus paracasei)

Protein Length: 31 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GMSGYIQGIPDFLKGYLHGISAANKHKKGRL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 1, 'N': 1, 'D': 1, 'C': 0, 'Q': 1, 'E': 0, 'G': 6, 'H': 2, 'I': 3, 'L': 3, 'K': 4, 'M': 1, 'F': 1, 'P': 1, 'S': 2, 'T': 0, 'W': 0, 'Y': 2, 'V': 0

Frequencies of Amino Acids

'A': 6.45%, 'R': 3.23%, 'N': 3.23%, 'D': 3.23%, 'C': 0%, 'Q': 3.23%, 'E': 0%, 'G': 19.35%, 'H': 6.45%, 'I': 9.68%, 'L': 9.68%, 'K': 12.9%, 'M': 3.23%, 'F': 3.23%, 'P': 3.23%, 'S': 6.45%, 'T': 0%, 'W': 0%, 'Y': 6.45%, 'V': 0%

Missing Amino Acid(s)

C, E, T, V, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, F, M, N, P, Q, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3357.92 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	81.936	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	10.819	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.387	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.568	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.578	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.177	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.29, 0.323, 0.194 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.097	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 2980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Listeria (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-listeria, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Vignolo G, Fadda S, de Kairuz MN, et al. Control of Listeria monocytogenes in ground beef by 'Lactocin 705', a bacteriocin produced by Lactobacillus casei CRL 705). Int J Food Microbiol. 1996;29(2-3):397-402. Published 1996 Apr. doi:10.1016/0168-1605(95)00038-0

PMID: 8796440

5.2 Protein Sequence Databases

UniProt: P80959

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P80959

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012517

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download