AMPDB_57862 | Hemiptericin

PEPTIDE SUMMARY

Hemiptericin

1 General Description

AMPDB ID: AMPDB_57862

Protein Names: Hemiptericin

Protein Family: Nil

Gene Name: Nil

Source Organism: Pyrrhocoris apterus (Sap sucking bug) (Cimex apterus)

Protein Length: 133 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

DVELKGKGGENEGFVGLKAQRNLYEDDRTSLSGTVKGQSQWKDPYPAQHAGMARLDGTRTLIENDRTKVTGSGFAQREVATGMRPHDSFGVGVEATHNIYKGKNGEVDVFGGVQRQWNTPDRHQARGGIRWRF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 12, 'N': 6, 'D': 9, 'C': 0, 'Q': 8, 'E': 8, 'G': 20, 'H': 4, 'I': 3, 'L': 6, 'K': 8, 'M': 2, 'F': 5, 'P': 4, 'S': 5, 'T': 9, 'W': 3, 'Y': 3, 'V': 10

Frequencies of Amino Acids

'A': 6.02%, 'R': 9.02%, 'N': 4.51%, 'D': 6.77%, 'C': 0%, 'Q': 6.02%, 'E': 6.02%, 'G': 15.04%, 'H': 3.01%, 'I': 2.26%, 'L': 4.51%, 'K': 6.02%, 'M': 1.5%, 'F': 3.76%, 'P': 3.01%, 'S': 3.76%, 'T': 6.77%, 'W': 2.26%, 'Y': 2.26%, 'V': 7.52%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	14744.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	54.211	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	23.414	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.957	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.623	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.89	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.375	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.226, 0.263, 0.18 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.083	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	20970, 20970	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Cociancich S, Dupont A, Hegy G, et al. Novel inducible antibacterial peptides from a hemipteran insect, the sap-sucking bug Pyrrhocoris apterus. Biochem J. 1994;300 ( Pt 2)(Pt 2):567-75. Published 1994 Jun 1. doi:10.1042/bj3000567

PMID: 8002963

5.2 Protein Sequence Databases

UniProt: P37363

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P37363

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download