AMPDB_578 | Esculentin-1SIa

PEPTIDE SUMMARY

Esculentin-1SIa

1 General Description

AMPDB ID: AMPDB_578

Protein Names: Esculentin-1SIa

Protein Family: Frog skin active peptide (FSAP) family; Esculentin subfamily

Gene Name: Nil

Source Organism: Odorrana ishikawae (Ishikawa`s frog) (Rana ishikawae)

Protein Length: 84 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTLKKPLLLIVLLGIISLSLCEQERAADEDEGSEIKRGIFSKFAGKGIKNLLVKGVKNIGKEVGMDVIRTGIDIAGCKIKGEC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 3, 'N': 2, 'D': 4, 'C': 3, 'Q': 1, 'E': 7, 'G': 11, 'H': 0, 'I': 11, 'L': 10, 'K': 11, 'M': 2, 'F': 3, 'P': 1, 'S': 4, 'T': 2, 'W': 0, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 4.76%, 'R': 3.57%, 'N': 2.38%, 'D': 4.76%, 'C': 3.57%, 'Q': 1.19%, 'E': 8.33%, 'G': 13.1%, 'H': 0%, 'I': 13.1%, 'L': 11.9%, 'K': 13.1%, 'M': 2.38%, 'F': 3.57%, 'P': 1.19%, 'S': 4.76%, 'T': 2.38%, 'W': 0%, 'Y': 0%, 'V': 5.95%

Missing Amino Acid(s)

H, W, Y

Most Occurring Amino Acid(s)

G, I, K

Less Occurring Amino Acid(s)

P, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9061.86 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	119.524	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	14.004	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.231	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.732	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.923	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.823	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.345, 0.214, 0.274 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.036	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-MRSA, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Iwakoshi-Ukena E, Ukena K, Okimoto A, et al. Identification and characterization of antimicrobial peptides from the skin of the endangered frog Odorrana ishikawae. Peptides. 2011;32(4):670-6. Published 2011 Apr. doi:10.1016/j.peptides.2010.12.013

PMID: 21193000

5.2 Protein Sequence Databases

UniProt: F1T149

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: F1T149

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB602051	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download