AMPDB_57 | Oxyopinin-4a
PEPTIDE SUMMARY
Oxyopinin-4a
1 General Description
AMPDB ID: AMPDB_57
Protein Names: Oxyopinin-4a (Oxt-4a)
Protein Family: Nil
Gene Name: Nil
Protein Length: 77 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKISQVFIFVFLLMISVAWANEAYEEESNYLSERFDADVEEITPEFRGIRCPKSWKCKAFKQRVLKRLLAMLRQHAF
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 7, 'R': 6, 'N': 2, 'D': 2, 'C': 2, 'Q': 3, 'E': 8, 'G': 1, 'H': 1, 'I': 5, 'L': 7, 'K': 6, 'M': 3, 'F': 7, 'P': 2, 'S': 5, 'T': 1, 'W': 2, 'Y': 2, 'V': 5
Frequencies of Amino Acids
'A': 9.09%, 'R': 7.79%, 'N': 2.6%, 'D': 2.6%, 'C': 2.6%, 'Q': 3.9%, 'E': 10.39%, 'G': 1.3%, 'H': 1.3%, 'I': 6.49%, 'L': 9.09%, 'K': 7.79%, 'M': 3.9%, 'F': 9.09%, 'P': 2.6%, 'S': 6.49%, 'T': 1.3%, 'W': 2.6%, 'Y': 2.6%, 'V': 6.49%
Missing Amino Acid(s)
No Amino Acid(s) are missing in this protein
Most Occurring Amino Acid(s)
E
Less Occurring Amino Acid(s)
G, H, T
Hydrophobic Amino Acid(s) Count
39
Hydrophilic Amino Acid(s) Count
38
Basic Amino Acid(s) Count
10
Acidic Amino Acid(s) Count
13
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 9204.81 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 88.701 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 39.874 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.075 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.825 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 8.75 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 1.977 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.364, 0.13, 0.325 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.143 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 13980, 14105 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
B.subtilis (Gram-positive), E.coli (Gram-negative), P.fluorescens (Gram-negative), S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Cytolysis, Toxin, Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Dubovskii PV, Vassilevski AA, Samsonova OV, et al. Novel lynx spider toxin shares common molecular architecture with defense peptides from frog skin. FEBS J. 2011;278(22):4382-93. Published 2011 Nov. doi:10.1111/j.1742-4658.2011.08361.x
PMID: 21933345
5.2 Protein Sequence Databases
UniProt: F8J4S0
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: F8J4S0
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. FN997582 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India