AMPDB_567 | Antimicrobial peptide 1
PEPTIDE SUMMARY
Antimicrobial peptide 1
1 General Description
AMPDB ID: AMPDB_567
Protein Names: Antimicrobial peptide 1 (SmAMP1) [Cleaved into: Antimicrobial peptide 1.1a (SmAMP1.1a) (SmMP1.1a); Antimicrobial peptide 1.2a (Sm-AMP-1.2a)]
Protein Family: Nil
Gene Name: Nil
Protein Length: 167 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MLNMKSFALVMLFATLVGVTIASGPNGQCGPGWGGCRGGLCCSQYGYCGSGPKYCAHNTPLSEIEPTDAGRCSGRGTCSGGRCCSKYGYCGTGPAYCGLGMCQGSCLPDMPNHPAQIQARTEAAQAEAQAEAYNQANEAAQVEAYYQATQAQTQAQPQVEPAVTKAP
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 23, 'R': 5, 'N': 6, 'D': 2, 'C': 14, 'Q': 15, 'E': 8, 'G': 23, 'H': 2, 'I': 3, 'L': 8, 'K': 4, 'M': 5, 'F': 2, 'P': 12, 'S': 9, 'T': 10, 'W': 1, 'Y': 9, 'V': 6
Frequencies of Amino Acids
'A': 13.77%, 'R': 2.99%, 'N': 3.59%, 'D': 1.2%, 'C': 8.38%, 'Q': 8.98%, 'E': 4.79%, 'G': 13.77%, 'H': 1.2%, 'I': 1.8%, 'L': 4.79%, 'K': 2.4%, 'M': 2.99%, 'F': 1.2%, 'P': 7.19%, 'S': 5.39%, 'T': 5.99%, 'W': 0.6%, 'Y': 5.39%, 'V': 3.59%
Missing Amino Acid(s)
No Amino Acid(s) are missing in this protein
Most Occurring Amino Acid(s)
A, G
Less Occurring Amino Acid(s)
W
Hydrophobic Amino Acid(s) Count
83
Hydrophilic Amino Acid(s) Count
84
Basic Amino Acid(s) Count
10
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 17251.4 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 49.88 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 25.539 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.285 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.567 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 6.429 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -1.682 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.174, 0.299, 0.263 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.072 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 18910, 19785 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
A.alternata, P.infestans
4.2 Antimicrobial Activity
Antimicrobial, Fungicide
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: R Shukurov R, D Voblikova V, Nikonorova AK, et al. Transformation of tobacco and Arabidopsis plants with Stellaria media genes encoding novel hevein-like peptides increases their resistance to fungal pathogens. Transgenic Res. 2012;21(2):313-25. Published 2012 Apr. doi:10.1007/s11248-011-9534-6
PMID: 21706181
Citation 2: Slavokhotova AA, Shelenkov AA, Korostyleva TV, et al. Defense peptide repertoire of Stellaria media predicted by high throughput next generation sequencing. Biochimie. 2017;135:15-27. Published 2017 Apr. doi:10.1016/j.biochi.2016.12.017
PMID: 28038935
5.2 Protein Sequence Databases
UniProt: E1UYT9
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: E1UYT9
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. FN663151 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: PS00026, PS50941
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India