AMPDB_562 | Antifungal protein B

1 General Description

AMPDB ID: AMPDB_562

Protein Names: Antifungal protein B

Protein Family: Antifungal protein pafB family

Gene Name: pafB

Source Organism: Penicillium chrysogenum (Penicillium notatum)

Protein Length: 92 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MQITSIAIVFFAAMGAVANPIARESDDLDARDVQLSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV

FASTA format

Counts of Amino Acids

'A': 9, 'R': 4, 'N': 5, 'D': 7, 'C': 6, 'Q': 3, 'E': 4, 'G': 6, 'H': 6, 'I': 4, 'L': 4, 'K': 8, 'M': 2, 'F': 3, 'P': 2, 'S': 6, 'T': 4, 'W': 0, 'Y': 2, 'V': 7

Frequencies of Amino Acids

'A': 9.78%, 'R': 4.35%, 'N': 5.43%, 'D': 7.61%, 'C': 6.52%, 'Q': 3.26%, 'E': 4.35%, 'G': 6.52%, 'H': 6.52%, 'I': 4.35%, 'L': 4.35%, 'K': 8.7%, 'M': 2.17%, 'F': 3.26%, 'P': 2.17%, 'S': 6.52%, 'T': 4.35%, 'W': 0%, 'Y': 2.17%, 'V': 7.61%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, P, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10119.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	65.761	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.196	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.486	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.601	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.846	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.178	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.217, 0.207, 0.207 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.054	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Aspergillus terreus, Bacillus subtilis (Gram-positive), Candida albicans, Escherichia coli (Gram-negative), Neurospora crassa, Penicillium digitatum, Trichophyton rubrum

4.2 Antimicrobial Activity

Antimicrobial, Fungicide, Anti-candida, Anti-yeast, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: RodrÃguez-MartÃn A, Acosta R, Liddell S, et al. Characterization of the novel antifungal protein PgAFP and the encoding gene of Penicillium chrysogenum. Peptides. 2010;31(4):541-7. Published 2010 Apr. doi:10.1016/j.peptides.2009.11.002

PMID: 19914321

Citation 2: Acosta R, RodrÃguez-MartÃn A, MartÃn A, et al. Selection of antifungal protein-producing molds from dry-cured meat products. Int J Food Microbiol. 2009;135(1):39-46. Published 2009 Sep 30. doi:10.1016/j.ijfoodmicro.2009.07.020

PMID: 19683356

Citation 3: Huber A, Lerchster H, Marx F, et al. Nutrient Excess Triggers the Expression of the Penicillium chrysogenum Antifungal Protein PAFB. Microorganisms. 2019;7(12). Published 2019 Dec 4. doi:10.3390/microorganisms7120654

PMID: 31817241

Citation 4: GandÃa M, Kakar A, Giner-Llorca M, et al. Potential of Antifungal Proteins (AFPs) to Control Penicillium Postharvest Fruit Decay. J Fungi (Basel). 2021;7(6). Published 2021 Jun 4. doi:10.3390/jof7060449

PMID: 34199956

Citation 5: Holzknecht J, Dubrac S, Hedtrich S, et al. Small, Cationic Antifungal Proteins from Filamentous Fungi Inhibit Candida albicans Growth in 3D Skin Infection Models. Microbiol Spectr. 2022;10(3):e0029922. Published 2022 Jun 29. doi:10.1128/spectrum.00299-22

PMID: 35499318

Citation 6: Huber A, Hajdu D, Bratschun-Khan D, et al. New Antimicrobial Potential and Structural Properties of PAFB: A Cationic, Cysteine-Rich Protein from Penicillium chrysogenum Q176. Sci Rep. 2018;8(1):1751. Published 2018 Jan 29. doi:10.1038/s41598-018-20002-2

PMID: 29379111

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: D0EXD3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	GQ911150	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR023112, IPR022706

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download