AMPDB_561 | Bacteriocin plantaricin ASM1

PEPTIDE SUMMARY

Bacteriocin plantaricin ASM1

1 General Description

AMPDB ID: AMPDB_561

Protein Names: Bacteriocin plantaricin ASM1

Protein Family: Nil

Gene Name: bactA1

Source Organism: Lactiplantibacillus plantarum (Lactobacillus plantarum)

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MSKLVKTLTVDEISKIQTNGGKPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGGSYHC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 0, 'N': 1, 'D': 3, 'C': 5, 'Q': 1, 'E': 1, 'G': 10, 'H': 3, 'I': 2, 'L': 3, 'K': 5, 'M': 3, 'F': 1, 'P': 1, 'S': 7, 'T': 5, 'W': 2, 'Y': 5, 'V': 3

Frequencies of Amino Acids

'A': 4.69%, 'R': 0%, 'N': 1.56%, 'D': 4.69%, 'C': 7.81%, 'Q': 1.56%, 'E': 1.56%, 'G': 15.63%, 'H': 4.69%, 'I': 3.13%, 'L': 4.69%, 'K': 7.81%, 'M': 4.69%, 'F': 1.56%, 'P': 1.56%, 'S': 10.94%, 'T': 7.81%, 'W': 3.13%, 'Y': 7.81%, 'V': 4.69%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, F, N, P, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6890.82 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	48.75	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.953	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.214	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.496	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.862	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.958	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.25, 0.297, 0.156 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.125	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	18450, 18700	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cereus (Gram-positive), B.subtilis (Gram-positive), E.coli (Gram-negative), L.brevis (Gram-positive), L.curvatus (Gram-positive), L.lactis (Gram-positive), L.lindneri, L.mesenteroides (Gram-positive), L.monocytogenes (Gram-positive), L.pentosus (Gram-positive), L.sakei (Gram-positive), P.acidilactici (Gram-positive), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Hata T, Tanaka R, Ohmomo S, et al. Isolation and characterization of plantaricin ASM1: a new bacteriocin produced by Lactobacillus plantarum A-1. Int J Food Microbiol. 2010;137(1):94-9. Published 2010 Jan 31. doi:10.1016/j.ijfoodmicro.2009.10.021

PMID: 19939484

5.2 Protein Sequence Databases

UniProt: C7G1H4

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: C7G1H4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB474371	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download