AMPDB_55875 | Putative pyocin-like protein

PEPTIDE SUMMARY

Putative pyocin-like protein

1 General Description

AMPDB ID: AMPDB_55875

Protein Names: Putative pyocin-like protein (EC 3.1.-.-)

Protein Family: Nil

Gene Name: PAU_02824

Source Organism: Photorhabdus asymbiotica subsp. asymbiotica (strain ATCC 43949 3105-77) (Xenorhabdus luminescens (strain 2))

Protein Length: 265 AA

Protein Existence: Predicted

2 Protein Sequence & Composition

2.1 Sequence

MAATTRSAVAEGEALVMRYIGGSAVSAGRWLAAPNPLTVGLMGVFYSPELNQGEEDYLSQYHLRQIAEQFGKAPTRVRFRWVRDEKSGRMTVQGYHVSPESGLDKVPVHMMRLNRTTGNYEFWEPGENRPTILWTLNEQEFKVSSHTGNEEPPFIPSQITVLPIPSQIADKLRGRRFNNFDDFRRAFWKEVGNDLELSKQFDPNNLSTMKNGRAPYAKKTEQVGKRVKIELYHIQQISKEGDVYNLDNINAITPKQHIETHKNGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 16, 'R': 19, 'N': 17, 'D': 10, 'C': 0, 'Q': 13, 'E': 21, 'G': 20, 'H': 7, 'I': 13, 'L': 18, 'K': 16, 'M': 7, 'F': 11, 'P': 16, 'S': 15, 'T': 15, 'W': 5, 'Y': 9, 'V': 17

Frequencies of Amino Acids

'A': 6.04%, 'R': 7.17%, 'N': 6.42%, 'D': 3.77%, 'C': 0%, 'Q': 4.91%, 'E': 7.92%, 'G': 7.55%, 'H': 2.64%, 'I': 4.91%, 'L': 6.79%, 'K': 6.04%, 'M': 2.64%, 'F': 4.15%, 'P': 6.04%, 'S': 5.66%, 'T': 5.66%, 'W': 1.89%, 'Y': 3.4%, 'V': 6.42%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

123

Hydrophilic Amino Acid(s) Count

142

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	30249.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	70.264	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	52.892	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.698	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.725	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.594	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.664	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.275, 0.257, 0.234 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.094	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	40910, 40910	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wilkinson P, Waterfield NR, Crossman L, et al. Comparative genomics of the emerging human pathogen Photorhabdus asymbiotica with the insect pathogen Photorhabdus luminescens. BMC Genomics. 2009;10:302. Published 2009 Jul 7. doi:10.1186/1471-2164-10-302

PMID: 19583835

5.2 Protein Sequence Databases

UniProt: C7BQD8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C7BQD8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FM162591	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: 291112.PAU_02824

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR037146, IPR044925, IPR016128, IPR036302

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: pay:PAU_02824

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download