AMPDB_556 | Amphipathic peptide OcyC1

PEPTIDE SUMMARY

Amphipathic peptide OcyC1

1 General Description

AMPDB ID: AMPDB_556

Protein Names: Amphipathic peptide OcyC1 (Non-disulfide-bridged peptide 5.7) (NDBP-5.7) [Cleaved into: OcyC1f]

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Opisthacanthus cayaporum (South American scorpion)

Protein Length: 68 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKAQLCILLIALVLFQTFSQSDAILSAIWSGIKSLFGRRGLNDLDDLDELFDGEISQADVDFLNELMR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 3, 'N': 2, 'D': 8, 'C': 1, 'Q': 4, 'E': 3, 'G': 4, 'H': 0, 'I': 6, 'L': 13, 'K': 2, 'M': 2, 'F': 5, 'P': 0, 'S': 6, 'T': 1, 'W': 1, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 7.35%, 'R': 4.41%, 'N': 2.94%, 'D': 11.76%, 'C': 1.47%, 'Q': 5.88%, 'E': 4.41%, 'G': 5.88%, 'H': 0%, 'I': 8.82%, 'L': 19.12%, 'K': 2.94%, 'M': 2.94%, 'F': 7.35%, 'P': 0%, 'S': 8.82%, 'T': 1.47%, 'W': 1.47%, 'Y': 0%, 'V': 2.94%

Missing Amino Acid(s)

H, P, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7634.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	124.853	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.999	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.372	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.733	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	3.926	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-6.056	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.397, 0.176, 0.338 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.088	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-biofilm, Anti-candida

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Silva EC, Camargos TS, MaranhÃ£o AQ, et al. Cloning and characterization of cDNA sequences encoding for new venom peptides of the Brazilian scorpion Opisthacanthus cayaporum. Toxicon. 2009;54(3):252-61. Published 2009 Sep 1. doi:10.1016/j.toxicon.2009.04.010

PMID: 19379768

Citation 2: Schwartz EF, Camargos TS, Zamudio FZ, et al. Mass spectrometry analysis, amino acid sequence and biological activity of venom components from the Brazilian scorpion Opisthacanthus cayaporum. Toxicon. 2008;51(8):1499-508. Published 2008 Jun 15. doi:10.1016/j.toxicon.2008.03.029

PMID: 18502464

Citation 3: Guilhelmelli F, Vilela N, Smidt KS, et al. Activity of Scorpion Venom-Derived Antifungal Peptides against Planktonic Cells of Candida spp. and Cryptococcus neoformans and Candida albicans Biofilms. Front Microbiol. 2016;7:1844. Published 2016. doi:10.3389/fmicb.2016.01844

PMID: 27917162

5.2 Protein Sequence Databases

UniProt: C5J886

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C5J886

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FM998743	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download