AMPDB_552 | Esculentin-2-ALb

PEPTIDE SUMMARY

Esculentin-2-ALb

1 General Description

AMPDB ID: AMPDB_552

Protein Names: Esculentin-2-ALb (Amolopin-9b)

Protein Family: Frog skin active peptide (FSAP) family; Esculentin subfamily

Gene Name: Nil

Source Organism: Amolops loloensis (Lolokou Sucker Frog) (Staurois loloensis)

Protein Length: 76 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTMKKSLLLLFFLGTISLSLCEEERSADEDDGEKGVKRGIFSLIKTAAKFVGKNLLKQAGKAGVEHLACKANNQC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 2, 'N': 3, 'D': 3, 'C': 3, 'Q': 2, 'E': 6, 'G': 7, 'H': 1, 'I': 3, 'L': 11, 'K': 10, 'M': 2, 'F': 5, 'P': 0, 'S': 5, 'T': 3, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 9.21%, 'R': 2.63%, 'N': 3.95%, 'D': 3.95%, 'C': 3.95%, 'Q': 2.63%, 'E': 7.89%, 'G': 9.21%, 'H': 1.32%, 'I': 3.95%, 'L': 14.47%, 'K': 13.16%, 'M': 2.63%, 'F': 6.58%, 'P': 0%, 'S': 6.58%, 'T': 3.95%, 'W': 0%, 'Y': 0%, 'V': 3.95%

Missing Amino Acid(s)

P, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8292.74 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92.5	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	24.432	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.043	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.711	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.931	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.912	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.289, 0.197, 0.342 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.066	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.cereus (Gram-positive), B.pumilus (Gram-positive), C.albicans, E.coli (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wang M, Wang Y, Wang A, et al. Five novel antimicrobial peptides from skin secretions of the frog, Amolops loloensis. Comp Biochem Physiol B Biochem Mol Biol. 2010;155(1):72-6. Published 2010 Jan. doi:10.1016/j.cbpb.2009.10.003

PMID: 19843479

5.2 Protein Sequence Databases

UniProt: C5H0D5

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C5H0D5

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU311548	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012521, IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download