AMPDB_547 | Temporin-LK1

PEPTIDE SUMMARY

Temporin-LK1

1 General Description

AMPDB ID: AMPDB_547

Protein Names: Temporin-LK1

Protein Family: Frog skin active peptide (FSAP) family; Temporin subfamily

Gene Name: Nil

Source Organism: Limnonectes kuhlii (Kuhl`s Creek frog) (Rana kuhlii)

Protein Length: 65 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MFTMKKSLLLLFFLGAINLPLCQEERNAEEERRDGDDEGSVEVQKRFFPLLFGALSSMMPKLFGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 4, 'N': 2, 'D': 3, 'C': 1, 'Q': 2, 'E': 7, 'G': 5, 'H': 0, 'I': 1, 'L': 11, 'K': 5, 'M': 4, 'F': 7, 'P': 3, 'S': 4, 'T': 1, 'W': 0, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 4.62%, 'R': 6.15%, 'N': 3.08%, 'D': 4.62%, 'C': 1.54%, 'Q': 3.08%, 'E': 10.77%, 'G': 7.69%, 'H': 0%, 'I': 1.54%, 'L': 16.92%, 'K': 7.69%, 'M': 6.15%, 'F': 10.77%, 'P': 4.62%, 'S': 6.15%, 'T': 1.54%, 'W': 0%, 'Y': 0%, 'V': 3.08%

Missing Amino Acid(s)

H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, I, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7470.77 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	85.539	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	52.403	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.114	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.504	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.019	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.052	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.323, 0.215, 0.385 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.108	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), C.albicans, E.coli (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wang G, Wang Y, Ma D, et al. Five novel antimicrobial peptides from the Kuhl's wart frog skin secretions, Limnonectes kuhlii. Mol Biol Rep. 2013;40(2):1097-102. Published 2013 Feb. doi:10.1007/s11033-012-2152-4

PMID: 23054029

5.2 Protein Sequence Databases

UniProt: C3RT22

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: C3RT22

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU346905	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download