AMPDB_53523 | AA_kinase domain-containing protein

PEPTIDE SUMMARY

AA_kinase domain-containing protein

1 General Description

AMPDB ID: AMPDB_53523

Protein Names: AA_kinase domain-containing protein

Protein Family: Nil

Gene Name: F0L67_28060

Source Organism: Escherichia coli

Protein Length: 248 AA

Protein Existence: Predicted

2 Protein Sequence & Composition

2.1 Sequence

MSAGADPLRGLDLFGGGDRQGSGRQRRQVPGPSGLLAVALQAIGVPARSWLGSQVAIHTDAAHAKARIRSIDSAGLEAGWSRGEVAVIPGFQGIANDGSNRVTTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYTDKETVNVNERVVDDVKDERKNIKVVKGVQMSVTVVDAKHKERKGVVKERNKGENEMNIKVNNSKKEVQKIRKGVKNNTEKDVRREGFSKGGNTRDEVIRFTKDSGNNEVYV

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 22, 'R': 21, 'N': 15, 'D': 19, 'C': 1, 'Q': 8, 'E': 14, 'G': 29, 'H': 3, 'I': 11, 'L': 9, 'K': 21, 'M': 3, 'F': 4, 'P': 5, 'S': 15, 'T': 11, 'W': 2, 'Y': 3, 'V': 32

Frequencies of Amino Acids

'A': 8.87%, 'R': 8.47%, 'N': 6.05%, 'D': 7.66%, 'C': 0.4%, 'Q': 3.23%, 'E': 5.65%, 'G': 11.69%, 'H': 1.21%, 'I': 4.44%, 'L': 3.63%, 'K': 8.47%, 'M': 1.21%, 'F': 1.61%, 'P': 2.02%, 'S': 6.05%, 'T': 4.44%, 'W': 0.81%, 'Y': 1.21%, 'V': 12.9%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

117

Hydrophilic Amino Acid(s) Count

131

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	26636.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.742	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.187	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.604	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.698	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.302	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.233	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.246, 0.258, 0.194 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.036	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: A0A8E4AIP5

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A8E4AIP5

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	CP043541	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036393, IPR001048, IPR024575, IPR016128, IPR036302

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download