AMPDB_517 | Cytoinsectotoxin-4
PEPTIDE SUMMARY
Cytoinsectotoxin-4
1 General Description
AMPDB ID: AMPDB_517
Protein Names: Cytoinsectotoxin-4 (CIT-4)
Protein Family: Cationic peptide 06 (cytoinsectotoxin) family
Gene Name: Nil
Protein Length: 124 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKCFILAAALVLAFACIAASEPAETENEDLDDLSDLEDEEWLDELEEAAEYLESLREFEESRGYKDYMSKAKDLYKDIKKDKRVKAVMKSSYMKEAKKLYKDNPVRDAYQVYKGVKAGGKLLFG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 15, 'R': 4, 'N': 2, 'D': 12, 'C': 2, 'Q': 1, 'E': 16, 'G': 5, 'H': 0, 'I': 3, 'L': 14, 'K': 17, 'M': 4, 'F': 4, 'P': 2, 'S': 7, 'T': 1, 'W': 1, 'Y': 8, 'V': 6
Frequencies of Amino Acids
'A': 12.1%, 'R': 3.23%, 'N': 1.61%, 'D': 9.68%, 'C': 1.61%, 'Q': 0.81%, 'E': 12.9%, 'G': 4.03%, 'H': 0%, 'I': 2.42%, 'L': 11.29%, 'K': 13.71%, 'M': 3.23%, 'F': 3.23%, 'P': 1.61%, 'S': 5.65%, 'T': 0.81%, 'W': 0.81%, 'Y': 6.45%, 'V': 4.84%
Missing Amino Acid(s)
H
Most Occurring Amino Acid(s)
K
Less Occurring Amino Acid(s)
Q, T, W
Hydrophobic Amino Acid(s) Count
54
Hydrophilic Amino Acid(s) Count
70
Basic Amino Acid(s) Count
28
Acidic Amino Acid(s) Count
21
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 14211.2 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 79.597 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 48.19 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.588 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.665 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 4.506 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -7.104 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.29, 0.129, 0.395 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.105 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 17420, 17545 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
B.subtilis (Gram-positive), E.coli (Gram-negative)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Toxin, Insecticidal, Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Kuzmenkov AI, Sachkova MY, Kovalchuk SI, et al. Lachesana tarabaevi, an expert in membrane-active toxins. Biochem J. 2016;473(16):2495-506. Published 2016 Aug 15. doi:10.1042/BCJ20160436
PMID: 27287558
5.2 Protein Sequence Databases
UniProt: C0HJV6
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: C0HJV6
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. KT591340 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India